Project name: B LACTAMASE

Status: done

Started: 2026-06-15 17:47:35
Settings
Chain sequence(s) A: LIVTQTMKGLDIQKVAGTWYSLAMAASDISLLDAQSAPLRVYVEELKPTPEGDLEILLQKWENGECAQKKIIAEKTKIPAVFKIDALNENKVLVLDTDYKKYLLFCMENSAEPEQSLACQCLVRTPEVDDEALEKFDKALKALPMHIRLSFNPTQLEEQCHI
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:03:19)
[INFO]       Main:     Simulation completed successfully.                                          (00:03:20)
Show buried residues

Minimal score value
-3.9626
Maximal score value
1.6515
Average score
-1.0626
Total score value
-172.1337

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 L A 1.6515
2 I A 0.7350
3 V A 0.0000
4 T A 0.2498
5 Q A -0.4295
6 T A -0.5694
7 M A -1.1554
8 K A -2.0281
9 G A -1.3612
10 L A 0.0000
11 D A -1.8014
12 I A -1.6293
13 Q A -2.3297
14 K A -2.7158
15 V A 0.0000
16 A A -1.3447
17 G A -0.9166
18 T A -0.5419
19 W A 0.0000
20 Y A -0.5940
21 S A 0.0000
22 L A 0.0000
23 A A 0.0000
24 M A 0.0000
25 A A 0.0000
26 A A 0.0000
27 S A 0.0000
28 D A -0.7477
29 I A 0.4788
30 S A -0.1672
31 L A -0.3845
32 L A 0.0000
33 D A -1.7496
34 A A -1.2994
35 Q A -1.3273
36 S A -1.6890
37 A A 0.0000
38 P A -0.6886
39 L A -0.2131
40 R A -0.5967
41 V A -0.2514
42 Y A 0.0000
43 V A 0.0000
44 E A -1.0900
45 E A -1.0745
46 L A 0.0000
47 K A -1.5514
48 P A -1.7909
49 T A -1.5346
50 P A -1.5309
51 E A -2.4311
52 G A -2.2332
53 D A -2.1458
54 L A 0.0000
55 E A -0.8856
56 I A 0.0000
57 L A -1.2814
58 L A 0.0000
59 Q A 0.0000
60 K A -1.6227
61 W A -2.1562
62 E A -3.1283
63 N A -2.8901
64 G A -2.3698
65 E A -2.9377
66 C A -1.8428
67 A A -2.1210
68 Q A -2.4866
69 K A -2.2465
70 K A -2.1401
71 I A -0.6811
72 I A -0.4173
73 A A 0.0000
74 E A -2.5319
75 K A -2.7649
76 T A -1.8777
77 K A -1.6561
78 I A -0.5351
79 P A -1.0047
80 A A 0.0000
81 V A 0.0000
82 F A 0.0000
83 K A -2.3336
84 I A -1.7639
85 D A -2.3087
86 A A -1.3176
87 L A 0.3046
88 N A -1.5350
89 E A -2.6575
90 N A -2.0990
91 K A -1.6413
92 V A 0.0000
93 L A 0.0000
94 V A 0.0000
95 L A 0.0000
96 D A -1.0729
97 T A 0.0000
98 D A -1.3498
99 Y A -1.7179
100 K A -2.3253
101 K A -1.8567
102 Y A 0.0000
103 L A 0.0000
104 L A 0.0000
105 F A 0.0000
106 C A 0.0000
107 M A -0.0005
108 E A 0.0000
109 N A -1.4744
110 S A -1.3004
111 A A -1.6527
112 E A -2.5837
113 P A -1.7632
114 E A -2.8212
115 Q A -2.6618
116 S A -1.5302
117 L A 0.0000
118 A A 0.0000
119 C A 0.0000
120 Q A 0.0000
121 C A 0.0000
122 L A 0.0000
123 V A 0.0000
124 R A -1.2124
125 T A -1.1409
126 P A -1.3796
127 E A -1.9706
128 V A -0.7997
129 D A -1.9950
130 D A -3.3047
131 E A -3.5612
132 A A 0.0000
133 L A -2.5045
134 E A -3.9626
135 K A -3.1861
136 F A 0.0000
137 D A -3.1007
138 K A -2.9400
139 A A -1.9571
140 L A 0.0000
141 K A -2.2513
142 A A -1.0580
143 L A -0.8470
144 P A -0.9929
145 M A -0.9449
146 H A -0.7175
147 I A -0.5025
148 R A -1.1672
149 L A -0.5625
150 S A -0.3452
151 F A 0.0000
152 N A -1.1967
153 P A -1.4935
154 T A -1.3286
155 Q A -1.2201
156 L A 0.0000
157 E A -2.9499
158 E A -2.4861
159 Q A -2.0315
160 C A 0.0000
161 H A 0.0000
162 I A 0.8159
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018