Project name: b22e157d94e2de1

Status: done

Started: 2026-06-18 06:46:18
Settings
Chain sequence(s) A: QVQLQESGPGNVKPSETLSLTCTVSGGSVSSGDYYWTWIRQSPGKGLEWIGHIYYSGNTNYNPSLKSRLTISIDTSKTQFSLKLSSVTAADTAIYYCVRDRVTGAFDIWGQGTKVTVSSGGGGSGGGGSGGGGSGGGGSDIQMTQSASPEGASPGDRVTITCQASQDISNYLNWYQQKPGKAPKLLIYDASNLETGVPSRFSGSGSGTDFTFTISSLQPEDNATYFCQHFDHLPLAFGGGTKVEIK
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:03:07)
[INFO]       Main:     Simulation completed successfully.                                          (00:03:08)
Show buried residues

Minimal score value
-3.0274
Maximal score value
1.1003
Average score
-0.8211
Total score value
-201.9925

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 Q A -1.6327
2 V A -1.2886
3 Q A -1.9936
4 L A 0.0000
5 Q A -1.8667
6 E A 0.0000
7 S A -1.0169
8 G A -1.1424
9 P A -1.2636
10 G A -1.6584
11 N A -2.3287
12 V A 0.0000
13 K A -2.6217
14 P A -1.6800
15 S A -1.2869
16 E A -1.7061
17 T A -1.4050
18 L A 0.0000
19 S A -1.1276
20 L A 0.0000
21 T A -0.7114
22 C A 0.0000
23 T A -1.1636
24 V A 0.0000
25 S A -1.4731
26 G A -1.3455
27 G A -1.0509
28 S A -0.6803
29 V A 0.0000
30 S A -0.3639
31 S A -0.6526
32 G A -0.6672
33 D A -1.2556
34 Y A -0.0523
35 Y A 0.2972
36 W A 0.0000
37 T A 0.0000
38 W A 0.0000
39 I A 0.0000
40 R A 0.0000
41 Q A -0.9566
42 S A -1.0737
43 P A -0.9839
44 G A -1.4531
45 K A -2.2892
46 G A -1.4110
47 L A 0.0000
48 E A -0.8996
49 W A 0.0000
50 I A 0.0000
51 G A 0.0000
52 H A 0.0000
53 I A 0.0000
54 Y A -0.0157
55 Y A 0.0490
56 S A -0.3364
57 G A -0.7446
58 N A -1.3360
59 T A -0.7450
60 N A -0.7844
61 Y A -0.5981
62 N A -0.6937
63 P A -0.9652
64 S A -0.9060
65 L A 0.0000
66 K A -2.0627
67 S A -1.2994
68 R A -1.4442
69 L A 0.0000
70 T A -1.1303
71 I A 0.0000
72 S A -0.5655
73 I A -0.4588
74 D A -1.1008
75 T A -0.9507
76 S A -1.2757
77 K A -2.0832
78 T A -1.3539
79 Q A -1.2313
80 F A 0.0000
81 S A -0.6523
82 L A 0.0000
83 K A -1.8781
84 L A 0.0000
85 S A -1.1473
86 S A -1.1882
87 V A 0.0000
88 T A -0.6291
89 A A -0.2888
90 A A 0.0226
91 D A 0.0000
92 T A -0.4808
93 A A 0.0000
94 I A -0.5484
95 Y A 0.0000
96 Y A 0.0000
97 C A 0.0000
98 V A 0.0000
99 R A -0.1765
100 D A 0.0000
101 R A 0.0637
102 V A 1.1003
103 T A 0.4595
104 G A 0.3629
105 A A 0.0000
106 F A 0.0000
107 D A 0.0000
108 I A -0.4366
109 W A -0.9575
110 G A 0.0000
111 Q A -2.1761
112 G A -1.5031
113 T A -1.3783
114 K A -2.0694
115 V A 0.0000
116 T A -1.2798
117 V A 0.0000
118 S A -1.4126
119 S A -1.4298
120 G A -1.5219
121 G A -1.1457
122 G A -1.1207
123 G A -1.1302
124 S A -0.9181
125 G A -1.0583
126 G A -1.1595
127 G A -1.1320
128 G A -1.1489
129 S A -0.9987
130 G A -1.1738
131 G A -1.1769
132 G A -1.1990
133 G A -1.1717
134 S A -1.0387
135 G A -1.1770
136 G A -1.3720
137 G A -1.2584
138 G A -1.3521
139 S A -1.3801
140 D A -1.7710
141 I A 0.0000
142 Q A -1.9643
143 M A 0.0000
144 T A -1.1073
145 Q A -0.6073
146 S A -0.5608
147 A A -0.6517
148 S A -1.4983
149 P A -1.6655
150 E A -2.7123
151 G A -2.2257
152 A A 0.0000
153 S A -1.9027
154 P A -1.6316
155 G A -1.6638
156 D A -2.1715
157 R A -2.4910
158 V A 0.0000
159 T A -0.6646
160 I A 0.0000
161 T A -0.7646
162 C A 0.0000
163 Q A -2.4379
164 A A 0.0000
165 S A -2.1473
166 Q A -2.8712
167 D A -2.9813
168 I A 0.0000
169 S A -1.3945
170 N A -1.0999
171 Y A -0.2492
172 L A 0.0000
173 N A 0.0000
174 W A 0.0000
175 Y A 0.0000
176 Q A 0.0000
177 Q A -1.5611
178 K A -1.9984
179 P A -1.3432
180 G A -1.7151
181 K A -2.6722
182 A A -1.7381
183 P A 0.0000
184 K A -1.7148
185 L A 0.0000
186 L A 0.0000
187 I A 0.0000
188 Y A -0.0425
189 D A -0.4405
190 A A 0.0000
191 S A -0.6487
192 N A -0.6523
193 L A -0.0236
194 E A -0.3420
195 T A -0.2871
196 G A -0.4229
197 V A -0.2916
198 P A -0.3033
199 S A -0.3829
200 R A -0.7125
201 F A 0.0000
202 S A -0.4197
203 G A -0.4216
204 S A -0.9617
205 G A -1.2350
206 S A -1.5085
207 G A -1.9487
208 T A -2.4746
209 D A -2.8587
210 F A 0.0000
211 T A -0.8149
212 F A 0.0000
213 T A -0.6097
214 I A 0.0000
215 S A -1.3199
216 S A -1.5602
217 L A 0.0000
218 Q A -1.6184
219 P A -1.7750
220 E A -1.8085
221 D A 0.0000
222 N A -2.1147
223 A A 0.0000
224 T A -1.2980
225 Y A 0.0000
226 F A 0.0000
227 C A 0.0000
228 Q A 0.0000
229 H A 0.0000
230 F A 0.0000
231 D A -1.0376
232 H A -0.6509
233 L A 0.0062
234 P A -0.1986
235 L A 0.0000
236 A A -0.5606
237 F A -0.3306
238 G A 0.0000
239 G A -1.2593
240 G A -1.0231
241 T A 0.0000
242 K A -2.3076
243 V A 0.0000
244 E A -3.0274
245 I A -2.3971
246 K A -2.4348
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018