Project name: K27

Status: done

Started: 2026-07-15 15:52:45
Settings
Chain sequence(s) A: DLGKKLLEAARAGQDDEVRILMANGADVNAHDTFGFTPLHLAALYGHLEIVEVLLKNGADVNADDSYGRTPLHLAAMRGHLEIVEVLLKYGADVNAADEEGRTPLHLAAKRGHLEIVEVLLKNGADVNAQDKFGKTAFDISIDNGNEDLAEILQK
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:03:32)
[INFO]       Main:     Simulation completed successfully.                                          (00:03:34)
Show buried residues

Minimal score value
-4.1137
Maximal score value
1.5316
Average score
-1.1513
Total score value
-178.4482

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 D A -2.2864
2 L A -1.9686
3 G A -2.4887
4 K A -3.2499
5 K A -2.7878
6 L A 0.0000
7 L A 0.0000
8 E A -2.7191
9 A A 0.0000
10 A A 0.0000
11 R A -1.8196
12 A A -1.5449
13 G A -2.1921
14 Q A -3.7229
15 D A -4.1137
16 D A -3.7582
17 E A -3.1987
18 V A 0.0000
19 R A -2.8954
20 I A -0.8936
21 L A 0.0000
22 M A -1.1808
23 A A -0.7398
24 N A -1.4362
25 G A -1.1817
26 A A 0.0000
27 D A -2.4996
28 V A -1.5649
29 N A -1.7258
30 A A -1.6787
31 H A -1.4142
32 D A -0.6113
33 T A 0.4184
34 F A 1.5316
35 G A 0.0489
36 F A -0.0536
37 T A 0.0000
38 P A 0.0000
39 L A 0.0000
40 H A 0.0000
41 L A 0.0000
42 A A 0.0000
43 A A 0.0000
44 L A 0.0367
45 Y A 0.2423
46 G A -0.5773
47 H A -1.3134
48 L A -1.1921
49 E A -2.3569
50 I A 0.0000
51 V A 0.0000
52 E A -1.6006
53 V A -1.9071
54 L A 0.0000
55 L A 0.0000
56 K A -2.4349
57 N A -2.8452
58 G A -2.1159
59 A A 0.0000
60 D A -2.0678
61 V A -1.4361
62 N A -1.8031
63 A A -1.7914
64 D A -1.8282
65 D A 0.0000
66 S A 0.1911
67 Y A 0.1771
68 G A -1.2427
69 R A -1.1588
70 T A 0.0000
71 P A 0.0000
72 L A 0.0000
73 H A 0.0000
74 L A 0.0000
75 A A 0.0000
76 A A 0.0000
77 M A -0.9598
78 R A -1.2894
79 G A -1.4257
80 H A -0.9405
81 L A -1.3833
82 E A -2.1077
83 I A 0.0000
84 V A 0.0000
85 E A -2.4161
86 V A -1.4921
87 L A 0.0000
88 L A -1.5154
89 K A -1.9105
90 Y A -1.1535
91 G A -1.1838
92 A A 0.0000
93 D A -1.9222
94 V A 0.0000
95 N A -1.6838
96 A A -1.2038
97 A A -1.2546
98 D A 0.0000
99 E A -2.1874
100 E A -1.8691
101 G A -1.8616
102 R A -1.4606
103 T A 0.0000
104 P A 0.0000
105 L A 0.0000
106 H A 0.0000
107 L A 0.0000
108 A A 0.0000
109 A A 0.0000
110 K A -2.1991
111 R A -2.6467
112 G A -2.0004
113 H A -1.6660
114 L A -1.6119
115 E A -2.1098
116 I A 0.0000
117 V A 0.0000
118 E A -2.4035
119 V A 0.0000
120 L A 0.0000
121 L A -1.9893
122 K A -2.5790
123 N A -2.9663
124 G A -1.9966
125 A A 0.0000
126 D A -2.1572
127 V A -1.1267
128 N A -1.9248
129 A A -1.7855
130 Q A -2.1740
131 D A 0.0000
132 K A -1.8171
133 F A 0.3839
134 G A -0.8536
135 K A -1.5485
136 T A -1.3202
137 A A 0.0000
138 F A -0.6481
139 D A -1.0276
140 I A 0.0000
141 S A 0.0000
142 I A 0.0662
143 D A -1.9048
144 N A -2.4719
145 G A -1.8367
146 N A -2.4065
147 E A -3.1240
148 D A -3.3652
149 L A 0.0000
150 A A -2.2423
151 E A -3.5416
152 I A -2.5334
153 L A 0.0000
154 Q A -2.3666
155 K A -2.5809
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018