Project name: b303982ed383c80

Status: done

Started: 2026-07-01 15:23:12
Settings
Chain sequence(s) B: TSTLFQYQSLDSSGNVISSQRHTILGPPEIANVSISYVSPSVVQVTLTLL
input PDB
Selected Chain(s) B
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with B chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:16)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:16)
Show buried residues

Minimal score value
-3.0045
Maximal score value
2.7437
Average score
0.4621
Total score value
23.1055

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 T B 0.1453
2 S B 0.7113
3 T B 0.6300
4 L B 0.7500
5 F B -0.5071
6 Q B -2.0476
7 Y B -0.9379
8 Q B -0.5076
9 S B 0.5485
10 L B 1.2181
11 D B -0.1440
12 S B -0.6330
13 S B -0.7534
14 G B -0.5230
15 N B -0.2541
16 V B 1.8000
17 I B 2.2625
18 S B 0.7573
19 S B -0.9203
20 Q B -2.7330
21 R B -3.0045
22 H B -1.6619
23 T B -0.0350
24 I B 1.0981
25 L B 1.5246
26 G B 0.2815
27 P B -0.1050
28 P B -0.1266
29 E B -0.8995
30 I B 0.2919
31 A B 0.1759
32 N B -0.4651
33 V B 1.1777
34 S B 1.1205
35 I B 2.7437
36 S B 2.0000
37 Y B 2.6595
38 V B 2.7049
39 S B 1.2815
40 P B 0.5994
41 S B 0.7465
42 V B 1.7239
43 V B 2.0124
44 Q B 1.2073
45 V B 2.2090
46 T B 0.9553
47 L B 0.9717
48 T B 0.6269
49 L B 1.1218
50 L B 1.3071
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018