Project name: b3bcbd069853c98

Chain sequence(s)	A: MIIEYDGEIDFTKGRVVLWFSIPGSPPSRLVERFMTELSE
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:28)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:28)

• Minimal score value: -2.4474
• Maximal score value: 3.1012
• Average score: -0.1547
• Total score value: -6.188

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	M	A	1.5877
2	I	A	2.4882
3	I	A	2.1530
4	E	A	-0.3770
5	Y	A	-0.0376
6	D	A	-2.0119
7	G	A	-2.1380
8	E	A	-2.4474
9	I	A	-1.2575
10	D	A	-1.7587
11	F	A	-0.4899
12	T	A	-1.1774
13	K	A	-2.2820
14	G	A	-1.8029
15	R	A	-1.4472
16	V	A	0.8133
17	V	A	2.7664
18	L	A	3.1012
19	W	A	2.3546
20	F	A	2.9095
21	S	A	1.3594
22	I	A	1.8116
23	P	A	0.1129
24	G	A	-0.5647
25	S	A	-0.3172
26	P	A	-0.5989
27	P	A	-0.7275
28	S	A	-0.4288
29	R	A	-1.8215
30	L	A	-0.1569
31	V	A	-0.1499
32	E	A	-1.6539
33	R	A	-1.4754
34	F	A	0.4540
35	M	A	0.1363
36	T	A	-0.7027
37	E	A	-1.4695
38	L	A	0.3953
39	S	A	0.1150
40	E	A	-1.4520