Project name: b3bcbd069853c98

Status: done

Started: 2026-03-26 08:16:54
Settings
Chain sequence(s) A: MIIEYDGEIDFTKGRVVLWFSIPGSPPSRLVERFMTELSE
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:28)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:28)
Show buried residues

Minimal score value
-2.4474
Maximal score value
3.1012
Average score
-0.1547
Total score value
-6.188

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 M A 1.5877
2 I A 2.4882
3 I A 2.1530
4 E A -0.3770
5 Y A -0.0376
6 D A -2.0119
7 G A -2.1380
8 E A -2.4474
9 I A -1.2575
10 D A -1.7587
11 F A -0.4899
12 T A -1.1774
13 K A -2.2820
14 G A -1.8029
15 R A -1.4472
16 V A 0.8133
17 V A 2.7664
18 L A 3.1012
19 W A 2.3546
20 F A 2.9095
21 S A 1.3594
22 I A 1.8116
23 P A 0.1129
24 G A -0.5647
25 S A -0.3172
26 P A -0.5989
27 P A -0.7275
28 S A -0.4288
29 R A -1.8215
30 L A -0.1569
31 V A -0.1499
32 E A -1.6539
33 R A -1.4754
34 F A 0.4540
35 M A 0.1363
36 T A -0.7027
37 E A -1.4695
38 L A 0.3953
39 S A 0.1150
40 E A -1.4520
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018