Project name: query_structure

Status: done

Started: 2026-03-16 19:56:41
Settings
Chain sequence(s) A: CAFKADDGPCKAIMKRFFFNIFTRQCEEFIYGGCEGNQNRFESLEECKKMC
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:52)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:53)
Show buried residues

Minimal score value
-2.9953
Maximal score value
1.684
Average score
-0.9599
Total score value
-48.9556

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
26 C A 1.1893
27 A A 1.3252
28 F A 1.0619
29 K A -1.1283
30 A A -1.4053
31 D A -2.2014
32 D A -2.3756
33 G A -2.0011
34 P A -1.3911
35 C A -0.9168
36 K A -1.2937
37 A A 0.1770
38 I A 1.6840
39 M A 0.4493
40 K A -1.1722
41 R A -1.7120
42 F A 0.0000
43 F A -1.0802
44 F A -0.1647
45 N A -0.0781
46 I A 1.1055
47 F A 1.5373
48 T A -0.1898
49 R A -1.4746
50 Q A -1.9858
51 C A -1.7424
52 E A -1.7767
53 E A -2.3249
54 F A -0.7838
55 I A 0.4935
56 Y A 0.0000
57 G A 0.0000
58 G A -0.6103
59 C A -1.4557
60 E A -2.4831
61 G A -2.4862
62 N A -1.7213
63 Q A -1.5638
64 N A 0.0000
65 R A -1.9473
66 F A 0.0000
67 E A -2.7384
68 S A -2.2964
69 L A -2.0607
70 E A -2.9953
71 E A -2.5140
72 C A 0.0000
73 K A -2.8471
74 K A -2.4873
75 M A -0.3527
76 C A -0.2205
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018