Project name: 2s_albumin

Status: done

Started: 2026-06-01 23:43:34
Settings
Chain sequence(s) A: RCRHQFQTQQRLRACQRVIRRWSQPPTLQRCCRQLRNVSPFCRCPSLRQAVQSAQQQQGQVGPQQVGHMYRVASRIPAICNLQPMRCPFR
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:57)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:58)
Show buried residues

Minimal score value
-3.617
Maximal score value
1.5201
Average score
-1.3917
Total score value
-125.2519

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
40 R A -2.5555
41 C A -1.9368
42 R A -3.4130
43 H A -3.1070
44 Q A -2.7153
45 F A 0.0000
46 Q A -3.0826
47 T A -2.1679
48 Q A -2.8966
49 Q A -2.9408
50 R A -3.4677
51 L A 0.0000
52 R A -3.4233
53 A A 0.0000
54 C A 0.0000
55 Q A 0.0000
56 R A -3.1932
57 V A 0.0000
58 I A 0.0000
59 R A -2.9824
60 R A -2.7765
61 W A -1.3246
62 S A 0.0000
63 Q A -1.8533
93 P A -0.8148
94 P A -0.8373
95 T A -1.4254
96 L A -0.9558
97 Q A -1.8049
98 R A -2.6257
99 C A 0.0000
100 C A -2.0842
101 R A -3.4519
102 Q A -3.2662
103 L A 0.0000
104 R A -3.6170
105 N A -2.8226
106 V A 0.0000
107 S A -0.5045
108 P A 0.0525
109 F A 1.5201
110 C A 0.0000
111 R A 0.0000
112 C A -0.5149
113 P A -0.8957
114 S A 0.0000
115 L A 0.0000
116 R A -2.0956
117 Q A -2.0936
118 A A 0.0000
119 V A 0.0000
120 Q A -1.9255
121 S A -2.0262
122 A A 0.0000
123 Q A -1.9928
124 Q A -2.4086
125 Q A -2.6425
126 Q A -1.8131
127 G A -1.6275
128 Q A -1.7986
129 V A -1.0591
130 G A -1.1526
131 P A -1.2038
132 Q A -1.7074
133 Q A -1.9026
134 V A -1.3381
135 G A -1.3987
136 H A -2.1291
137 M A 0.0000
138 Y A -1.6872
139 R A -2.5471
140 V A -1.6425
141 A A 0.0000
142 S A -2.2028
143 R A -2.3556
144 I A 0.0000
145 P A 0.0000
146 A A -1.0866
147 I A 0.0028
148 C A -1.0075
149 N A -1.3433
150 L A 0.0000
151 Q A -1.6409
152 P A -1.0182
153 M A -1.5130
154 R A -2.4897
155 C A 0.0000
156 P A -1.3120
157 F A -1.4712
158 R A -1.7369
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018