Project name: b4040c680273880

Status: done

Started: 2026-07-01 15:22:37
Settings
Chain sequence(s) B: MKTVSLSRVMTPEDAGQLFRWGFSSSPSTEALEASARANPEVFTLRLVPP
input PDB
Selected Chain(s) B
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with B chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:18)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:19)
Show buried residues

Minimal score value
-2.4675
Maximal score value
1.8406
Average score
-0.3561
Total score value
-17.8066

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 M B 0.2509
2 K B -1.0265
3 T B -0.0546
4 V B 0.8770
5 S B 0.6164
6 L B 1.1140
7 S B 0.2147
8 R B 0.0127
9 V B 1.2986
10 M B 0.7044
11 T B -0.2930
12 P B -0.8843
13 E B -2.0532
14 D B 0.0000
15 A B -1.0740
16 G B -1.3190
17 Q B -1.3973
18 L B 0.7915
19 F B 0.1592
20 R B -1.4070
21 W B -0.2257
22 G B 0.0805
23 F B 1.8406
24 S B 0.5729
25 S B 0.1979
26 S B -0.1581
27 P B -0.2414
28 S B -0.8267
29 T B -1.1137
30 E B -2.0687
31 A B -0.9539
32 L B -0.2927
33 E B -1.8732
34 A B -1.2420
35 S B -0.6814
36 A B -1.3910
37 R B -2.4675
38 A B -1.2519
39 N B -1.3747
40 P B -1.4075
41 E B -1.8401
42 V B 0.0016
43 F B 0.5313
44 T B 0.1632
45 L B -0.3820
46 R B -1.0091
47 L B 0.6571
48 V B 1.6439
49 P B 0.5495
50 P B 0.2257
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018