Project name: b02862b239ace67 [mutate: QR3B, VR2B, QR1B, VR5B, LA4B, EN6B, SC7B, GE8B]

Status: done

Started: 2026-06-07 10:09:33
Settings
Chain sequence(s) B: QVQLVESGGGLVQPGGSLRLSCAASGFPFSSYGMGWVRQAPGKGLEWVSGINWSGGSTGYADSVKGRFTISRDNAKNTLYLQMNSLRAEDTAVYYCADGLLFSYDDWGQGTQVTVSS
input PDB
Selected Chain(s) B
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Mutated residues LA4B,VR5B,EN6B,SC7B,QR1B,VR2B,QR3B,GE8B
Energy difference between WT (input) and mutated protein (by FoldX) 13.4915 kcal/mol

CAUTION: Your mutation/s can destabilize the protein structure

Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with B chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       FoldX:    Building mutant model                                                       (00:00:22)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:02:27)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:02:53)
[INFO]       Main:     Simulation completed successfully.                                          (00:02:53)
Show buried residues

Minimal score value
-3.2067
Maximal score value
3.1532
Average score
-0.7441
Total score value
-87.0544

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 R B -2.6711 mutated: QR1B
2 R B -2.5873 mutated: VR2B
3 R B -3.2067 mutated: QR3B
4 A B -2.3107 mutated: LA4B
5 R B -2.4767 mutated: VR5B
6 N B 0.0000 mutated: EN6B
7 C B -1.6004 mutated: SC7B
8 E B -2.0742 mutated: GE8B
9 G B -1.2868
10 G B -0.2886
11 L B 0.7614
12 V B 0.0000
13 Q B -1.5490
14 P B -1.8830
15 G B -1.5822
16 G B -1.0531
17 S B -1.2162
18 L B -0.9626
19 R B -1.9715
20 L B 0.0000
21 S B -1.0741
22 C B 0.0000
23 A B -1.3794
24 A B 0.0000
25 S B -1.8591
26 G B -1.7345
27 F B -0.9218
28 P B -0.5271
29 F B 0.0000
30 S B -0.7449
31 S B -0.0755
32 Y B 0.6857
33 G B 0.9437
34 M B 0.0000
35 G B 0.0000
36 W B 0.0000
37 V B 0.0000
38 R B 0.0000
39 Q B -0.8560
40 A B -1.3633
41 P B -0.9968
42 G B -1.4640
43 K B -2.1933
44 G B -1.0795
45 L B 0.2251
46 E B -0.6244
47 W B 0.0833
48 V B 0.0000
49 S B 0.0000
50 G B 0.1332
51 I B 0.0000
52 N B 0.1176
53 W B -0.0647
54 S B -0.5766
55 G B -0.8587
56 G B -0.7440
57 S B -0.6311
58 T B -0.4478
59 G B -0.6213
60 Y B -0.9433
61 A B -1.4373
62 D B -2.5085
63 S B -1.7322
64 V B 0.0000
65 K B -2.6573
66 G B -1.7831
67 R B -1.5506
68 F B 0.0000
69 T B -0.8296
70 I B 0.0000
71 S B -0.5977
72 R B -1.1611
73 D B -1.8465
74 N B -2.2543
75 A B -1.6929
76 K B -2.4439
77 N B -1.9529
78 T B 0.0000
79 L B 0.0000
80 Y B -0.6144
81 L B 0.0000
82 Q B -1.0604
83 M B 0.0000
84 N B -1.4168
85 S B -1.4067
86 L B 0.0000
87 R B -2.9579
88 A B -2.0719
89 E B -2.4492
90 D B 0.0000
91 T B -1.0026
92 A B 0.0000
93 V B -0.1697
94 Y B 0.0000
95 Y B -0.2825
96 C B 0.0000
97 A B 0.0000
98 D B 0.0000
99 G B 0.0000
100 L B 2.5210
101 L B 3.1532
102 F B 2.7823
103 S B 1.3253
104 Y B 0.3912
105 D B -1.2767
106 D B -1.4360
107 W B -0.8582
108 G B -1.4344
109 Q B -1.6690
110 G B -1.0638
111 T B -1.3200
112 Q B -1.1287
113 V B 0.0000
114 T B -0.4037
115 V B 0.0000
116 S B -0.6843
117 S B -0.5213
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018