Project name: obj1 [mutate: WC47C, LF45C, EP46C, VW48C, KR43C]

Chain sequence(s)	C: EVQLVESGGGLVQPGGSLRLSCAASDFTFRSYEMSWVRQAPGKGLEWVSAISGSGGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAIYYCARLRDGFNKGFDYWGQGTLVTVSS
Selected Chain(s)	C
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No
Mutated residues	LF45C,EP46C,WC47C,VW48C,KR43C
Energy difference between WT (input) and mutated protein (by FoldX)	30.0115 kcal/mol CAUTION: Your mutation/s can destabilize the protein structure

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with C chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       FoldX:    Building mutant model                                                       (00:00:26)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:01:39)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:02:04)
[INFO]       Main:     Simulation completed successfully.                                          (00:02:05)

• Minimal score value: -3.3233
• Maximal score value: 1.745
• Average score: -0.6256
• Total score value: -75.0723

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	E	C	-2.0068
2	V	C	-0.9332
3	Q	C	-1.2658
4	L	C	0.0000
5	V	C	0.5434
6	E	C	0.2006
7	S	C	-0.4097
8	G	C	-0.8149
9	G	C	0.0122
10	G	C	0.9248
11	L	C	1.4406
12	V	C	-0.0385
13	Q	C	-1.3371
14	P	C	-1.4887
15	G	C	-1.4134
16	G	C	-0.9785
17	S	C	-1.2309
18	L	C	-0.9630
19	R	C	-2.1461
20	L	C	0.0000
21	S	C	-0.5418
22	C	C	0.0000
23	A	C	-0.2017
24	A	C	0.0000
25	S	C	-0.2017
26	D	C	0.0000
27	F	C	1.5458
28	T	C	0.2525
29	F	C	0.0000
30	R	C	-2.0328
31	S	C	-0.8867
32	Y	C	-1.2168
33	E	C	-1.1365
34	M	C	0.0000
35	S	C	0.0000
36	W	C	0.0000
37	V	C	0.0000
38	R	C	0.3616
39	Q	C	-0.0990
40	A	C	-0.9108
41	P	C	-1.3487
42	G	C	-1.4787
43	R	C	-2.1434	mutated: KR43C
44	G	C	-0.8780
45	F	C	0.9327	mutated: LF45C
46	P	C	0.5019	mutated: EP46C
47	C	C	1.0173	mutated: WC47C
48	W	C	0.0000	mutated: VW48C
49	S	C	0.0000
50	A	C	0.0000
51	I	C	0.0000
52	S	C	-0.5396
53	G	C	-1.2453
54	S	C	-1.2288
55	G	C	-1.0820
56	G	C	-0.7346
57	S	C	-0.2399
58	T	C	0.3483
59	Y	C	0.9277
60	Y	C	-0.1248
61	A	C	-0.8983
62	D	C	-2.3214
63	S	C	-1.7555
64	V	C	0.0000
65	K	C	-2.3417
66	G	C	-1.6163
67	R	C	0.0000
68	F	C	0.0000
69	T	C	-0.6322
70	I	C	0.0000
71	S	C	-0.5624
72	R	C	-1.3626
73	D	C	-1.9805
74	N	C	-2.1901
75	S	C	-1.7905
76	K	C	-2.3163
77	N	C	-1.6491
78	T	C	0.0000
79	L	C	0.0000
80	Y	C	-0.6695
81	L	C	0.0000
82	Q	C	-1.2336
83	M	C	0.0000
84	N	C	-1.3326
85	S	C	-1.2322
86	L	C	0.0000
87	R	C	-2.4721
88	A	C	-1.8894
89	E	C	-2.3503
90	D	C	0.0000
91	T	C	-0.4418
92	A	C	0.0000
93	I	C	1.0518
94	Y	C	0.0000
95	Y	C	0.5936
96	C	C	0.0000
97	A	C	0.0000
98	R	C	0.0000
99	L	C	0.0000
100	R	C	-3.1862
101	D	C	-3.3233
102	G	C	-2.0607
103	F	C	-1.1411
104	N	C	-2.4031
105	K	C	-3.1727
106	G	C	-1.9017
107	F	C	-1.0100
108	D	C	-1.1345
109	Y	C	-0.2736
110	W	C	0.4220
111	G	C	-0.1418
112	Q	C	-0.9156
113	G	C	0.0513
114	T	C	0.5524
115	L	C	1.7450
116	V	C	0.0000
117	T	C	0.3382
118	V	C	0.0000
119	S	C	-0.7749
120	S	C	-1.0602