Project name: ATPase2

Status: done

Started: 2026-02-11 17:26:43
Settings
Chain sequence(s) A: ASPEAALREANAPWVAARCADPAVLARAAADEESLLGVLDALDLELYDRFGPAAAGVGKTLHLGALLPPERRPLLERVARAERARLEAAILAAAEEAGLPPAEIAALRARLARLAELRVLAASGRDPAARAEDRALLDALRADPTAAALLARALAALRPERAARVAAVE
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:03:38)
[INFO]       Main:     Simulation completed successfully.                                          (00:03:39)
Show buried residues

Minimal score value
-3.6441
Maximal score value
0.8588
Average score
-0.7728
Total score value
-130.5969

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 A A -0.1066
2 S A -0.3350
3 P A -0.4354
4 E A -1.0214
5 A A -0.8051
6 A A -0.6785
7 L A -0.3900
8 R A -0.9835
9 E A -1.8166
10 A A -0.7155
11 N A 0.0000
12 A A -0.6434
13 P A -0.4531
14 W A 0.0850
15 V A 0.0000
16 A A -0.1061
17 A A -0.3051
18 R A -0.7128
19 C A 0.0000
20 A A -0.1837
21 D A -0.7389
22 P A -0.6171
23 A A -0.6715
24 V A 0.0000
25 L A -0.4061
26 A A -0.9562
27 R A -2.3742
28 A A 0.0000
29 A A -1.5266
30 A A -1.8193
31 D A -2.9563
32 E A -3.6441
33 E A -3.2614
34 S A 0.0000
35 L A 0.0000
36 L A -1.4635
37 G A -1.2495
38 V A 0.0000
39 L A 0.0000
40 D A -0.5042
41 A A -0.2775
42 L A 0.0000
43 D A 0.0000
44 L A -1.0158
45 E A -1.2743
46 L A 0.0000
47 Y A 0.0000
48 D A -2.6961
49 R A -2.5111
50 F A -0.8677
51 G A -0.4927
52 P A -0.2722
53 A A -0.0430
54 A A 0.0000
55 A A -0.0676
56 G A -0.3594
57 V A -0.4274
58 G A 0.0000
59 K A -0.2459
60 T A 0.0000
61 L A -0.0601
62 H A 0.0413
63 L A 0.0000
64 G A -0.1039
65 A A 0.3221
66 L A 0.7882
67 L A 0.0000
68 P A -0.8823
69 P A -1.4678
70 E A -2.4520
71 R A -1.9265
72 R A -1.7750
73 P A -1.4682
74 L A -1.9062
75 L A 0.0000
76 E A 0.0000
77 R A -2.4875
78 V A 0.0000
79 A A 0.0000
80 R A -2.0251
81 A A -1.6151
82 E A -1.5370
83 R A 0.0000
84 A A -1.2033
85 R A -1.9188
86 L A -0.7355
87 E A 0.0000
88 A A -0.6093
89 A A -0.5220
90 I A 0.0000
91 L A -0.7672
92 A A -0.8752
93 A A 0.0000
94 A A 0.0000
95 E A -2.7085
96 E A -2.7407
97 A A -1.5616
98 G A -1.7400
99 L A -1.2604
100 P A -1.0053
101 P A -0.9914
102 A A -0.9791
103 E A -1.8867
104 I A -1.5147
105 A A -1.0707
106 A A -1.1398
107 L A 0.0000
108 R A -2.1470
109 A A -1.3688
110 R A -1.1895
111 L A 0.0000
112 A A -1.4168
113 R A -1.8765
114 L A 0.0000
115 A A -1.2589
116 E A -2.0463
117 L A 0.0000
118 R A -1.0146
119 V A -0.7133
120 L A -0.4287
121 A A 0.0000
122 A A 0.0000
123 S A -0.8874
124 G A -1.1409
125 R A -2.0907
126 D A -1.5236
127 P A -1.2011
128 A A -0.8006
129 A A 0.0000
130 R A -1.1665
131 A A -0.7233
132 E A -0.9906
133 D A 0.0000
134 R A -0.5873
135 A A -0.4592
136 L A -0.3659
137 L A -0.3833
138 D A -0.9770
139 A A -0.7139
140 L A 0.0000
141 R A -1.6593
142 A A -1.1778
143 D A -1.6208
144 P A -1.0288
145 T A -0.8059
146 A A 0.0000
147 A A -1.0323
148 A A -0.6311
149 L A 0.0000
150 L A 0.0000
151 A A -0.5072
152 R A -0.9137
153 A A 0.0000
154 L A -0.2223
155 A A -0.4701
156 A A -0.1550
157 L A -0.2708
158 R A -0.5964
159 P A -0.9313
160 E A -1.5438
161 R A -1.1891
162 A A -0.7183
163 A A -0.4417
164 R A -0.9414
165 V A -0.2867
166 A A -0.0326
167 A A 0.2660
168 V A 0.8588
169 E A -0.9419
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018