Project name: b53ecd460c4f449

Status: done

Started: 2026-07-01 15:22:11
Settings
Chain sequence(s) B: MNFTISEELLPSGQGVLTLSGNTSELQPNTTLRWLSGGELVATAQVVITP
input PDB
Selected Chain(s) B
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with B chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:12)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:12)
Show buried residues

Minimal score value
-2.3982
Maximal score value
1.6264
Average score
-0.4206
Total score value
-21.0311

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 M B -0.0466
2 N B -1.4018
3 F B -0.1541
4 T B 0.7011
5 I B 1.6264
6 S B -0.2901
7 E B -1.6417
8 E B -1.8716
9 L B -0.0030
10 L B -0.1254
11 P B -0.3950
12 S B -0.5901
13 G B -0.7480
14 Q B -1.2258
15 G B -0.9684
16 V B -0.3358
17 L B 0.0976
18 T B 0.3562
19 L B 1.3470
20 S B 0.1227
21 G B -1.0171
22 N B -2.0263
23 T B -1.5474
24 S B -1.7552
25 E B -2.3982
26 L B -1.3801
27 Q B -1.6987
28 P B -1.0125
29 N B -0.9856
30 T B -0.9024
31 T B -0.9109
32 L B -0.6592
33 R B -1.0548
34 W B 0.6743
35 L B 1.0765
36 S B 0.1735
37 G B -0.6948
38 G B -0.7407
39 E B -1.0732
40 L B 0.6880
41 V B 1.3275
42 A B 0.6386
43 T B -0.2202
44 A B -0.6076
45 Q B -1.0465
46 V B 0.1810
47 V B 0.9981
48 I B 0.3520
49 T B 0.2172
50 P B -0.0800
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018