Project name: query_structure

Status: done

Started: 2026-03-16 23:10:51
Settings
Chain sequence(s) A: ESCVYIPCFTAVVGCTCKDKVCYLNGTPCG
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:21)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:22)
Show buried residues

Minimal score value
-2.6996
Maximal score value
2.9414
Average score
0.2387
Total score value
7.1603

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 E A -0.0716
2 S A 0.0936
3 C A 0.7216
4 V A 1.5003
5 Y A 2.0420
6 I A 1.5598
7 P A 1.0468
8 C A 0.0000
9 F A 2.4290
10 T A 2.0835
11 A A 2.1196
12 V A 2.9414
13 V A 2.7577
14 G A 1.1129
15 C A 0.0000
16 T A 0.0025
17 C A -0.4450
18 K A -2.1227
19 D A -2.6996
20 K A -1.8177
21 V A -1.0062
22 C A 0.0000
23 Y A -0.7905
24 L A -0.3336
25 N A -1.3646
26 G A -1.1559
27 T A -0.5777
28 P A -0.5689
29 C A 0.0924
30 G A -0.3888
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018