Project name: query_structure

Status: done

Started: 2026-03-16 23:31:09
Settings
Chain sequence(s) A: GSIPCAESCVYIPCFTGIAGCSCKNKVCYYN
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:18)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:18)
Show buried residues

Minimal score value
-2.0501
Maximal score value
2.3109
Average score
0.5846
Total score value
18.1238

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 G A -0.3417
2 S A 0.4895
3 I A 1.8708
4 P A 0.8942
5 C A 0.9494
6 A A 0.4436
7 E A 0.3947
8 S A 0.4747
9 C A 0.9539
10 V A 1.7105
11 Y A 2.1100
12 I A 1.7154
13 P A 1.1144
14 C A 1.6687
15 F A 2.3109
16 T A 1.7152
17 G A 1.4133
18 I A 2.2766
19 A A 1.1622
20 G A 0.4601
21 C A 0.0000
22 S A -0.0282
23 C A -0.3087
24 K A -1.6986
25 N A -2.0501
26 K A -1.3935
27 V A -0.4632
28 C A 0.0000
29 Y A 0.3120
30 Y A 0.8010
31 N A -0.8333
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018