Project name: query_structure

Status: done

Started: 2026-03-17 00:18:15
Settings
Chain sequence(s) A: QLQLVESGGGWVQAGGSRRLSCAASGRTLDSYAVGWFRQAPGKEREWVSCSRSDGTTYQSDSMKGRFTISRDNTKNTVYLQMNSLKAEDTAVYYCASRRSYGCDYYGMEYWGKGTLVTVSS
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:29)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:29)
Show buried residues

Minimal score value
-3.5444
Maximal score value
1.5746
Average score
-0.8265
Total score value
-100.0103

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 Q A -1.8953
2 L A 0.0000
3 Q A -1.7411
4 L A 0.0000
5 V A 0.1336
6 E A 0.0000
7 S A -0.2039
8 G A -0.5914
9 G A 0.1222
10 G A 0.7530
11 W A 1.0361
12 V A -0.2954
13 Q A -1.3655
14 A A -1.4535
15 G A -1.3195
16 G A -1.2319
17 S A -1.6634
18 R A -1.8494
19 R A -2.4438
20 L A 0.0000
21 S A -0.5516
22 C A 0.0000
23 A A -0.4332
24 A A 0.0000
25 S A -1.2338
26 G A -1.7786
27 R A -2.1940
28 T A -1.8537
29 L A 0.0000
30 D A -2.9135
31 S A -2.0022
32 Y A 0.0000
33 A A 0.0000
34 V A 0.0000
35 G A 0.0000
36 W A 0.0000
37 F A 0.0000
38 R A 0.0000
39 Q A -1.7419
40 A A -1.7353
41 P A -1.6097
42 G A -1.9705
43 K A -3.3411
44 E A -3.5444
45 R A -2.7365
46 E A -1.7236
47 W A -0.7350
48 V A 0.0000
49 S A 0.0000
50 C A 0.0000
51 S A 0.0000
52 R A -1.1188
53 S A -1.8454
54 D A -2.1367
55 G A -1.4445
56 T A -0.5534
57 T A -0.2177
58 Y A 0.0301
59 Q A -1.1827
60 S A 0.0000
61 D A -2.5506
62 S A -1.7695
63 M A 0.0000
64 K A -2.7616
65 G A -1.9045
66 R A -1.4749
67 F A 0.0000
68 T A -0.9156
69 I A 0.0000
70 S A -0.5063
71 R A -1.2627
72 D A -1.7627
73 N A -2.0854
74 T A -1.6527
75 K A -2.2187
76 N A -1.9641
77 T A 0.0000
78 V A 0.0000
79 Y A -0.6403
80 L A 0.0000
81 Q A -1.4484
82 M A 0.0000
83 N A -1.6104
84 S A -1.3003
85 L A 0.0000
86 K A -2.2009
87 A A -1.6882
88 E A -2.2311
89 D A 0.0000
90 T A -0.4260
91 A A 0.0000
92 V A 0.5052
93 Y A 0.0000
94 Y A -0.0767
95 C A 0.0000
96 A A 0.0000
97 S A 0.0000
98 R A -2.1996
99 R A -2.5681
100 S A -0.9595
101 Y A -0.0310
102 G A -0.6541
103 C A -0.3312
104 D A -0.9428
105 Y A 0.5884
106 Y A 0.9827
107 G A -0.4662
108 M A 0.0000
109 E A -1.7577
110 Y A -1.1092
111 W A -0.3867
112 G A -0.5912
113 K A -1.5085
114 G A -0.2838
115 T A 0.4194
116 L A 1.5746
117 V A 0.0000
118 T A 0.3166
119 V A 0.0000
120 S A -0.7797
121 S A -0.7994
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018