Project name: query_structure

Status: done

Started: 2026-03-16 23:12:32
Settings
Chain sequence(s) A: EVQLQASGGGLVQPGGSLRLSCTASGSIFSINAMGWYRQTPRKERELVAAISEGGSTKYGDSVKGRFTISRDFAKNTQMVYLQMNSLKAEDTAVYYCKAQTEGPIADWGTSQYEYWGQGTQVTVS
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:03:06)
[INFO]       Main:     Simulation completed successfully.                                          (00:03:07)
Show buried residues

Minimal score value
-3.7542
Maximal score value
1.6285
Average score
-0.8678
Total score value
-108.4746

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 E A -2.1162
2 V A -1.2044
3 Q A -1.7717
4 L A 0.0000
5 Q A -1.7252
6 A A -1.2011
7 S A -1.2090
8 G A -0.9437
9 G A -0.7420
10 G A 0.0132
11 L A 1.0608
12 V A 0.0283
13 Q A -1.2544
14 P A -1.5274
15 G A -1.3554
16 G A -0.9124
17 S A -1.3157
18 L A -1.1010
19 R A -2.2593
20 L A 0.0000
21 S A -0.8513
22 C A 0.0000
23 T A -0.7572
24 A A 0.0000
25 S A -1.2930
26 G A -1.1493
27 S A -0.3112
28 I A 0.5558
29 F A 1.6285
30 S A 0.1187
31 I A 0.0000
32 N A -1.8961
33 A A -1.5687
34 M A 0.0000
35 G A 0.0000
36 W A 0.0000
37 Y A -0.2529
38 R A 0.0000
39 Q A -2.1546
40 T A -2.3106
41 P A -1.9964
42 R A -3.2394
43 K A -3.7542
44 E A -3.6783
45 R A -2.8668
46 E A -1.6632
47 L A -0.6626
48 V A 0.0000
49 A A 0.0000
50 A A -0.5828
51 I A 0.0000
52 S A -1.8944
53 E A -2.3626
54 G A -1.7179
55 G A -1.6850
56 S A -1.3269
57 T A -1.3254
58 K A -2.0366
59 Y A -1.5281
60 G A -1.6272
61 D A -2.6074
62 S A -1.8320
63 V A 0.0000
64 K A -2.7921
65 G A -1.7428
66 R A -1.3842
67 F A 0.0000
68 T A -1.1341
69 I A 0.0000
70 S A -0.4198
71 R A -0.5986
72 D A -0.5820
73 F A 0.1965
74 A A -0.6283
75 K A -2.0674
76 N A -1.9846
77 T A -1.0690
78 Q A -0.7534
79 M A -0.2691
80 V A 0.0000
81 Y A -0.6965
82 L A 0.0000
83 Q A -1.6152
84 M A 0.0000
85 N A -1.4338
86 S A -1.2128
87 L A 0.0000
88 K A -2.2768
89 A A -1.7145
90 E A -2.2745
91 D A 0.0000
92 T A -0.8519
93 A A 0.0000
94 V A -0.4742
95 Y A 0.0000
96 Y A -0.5003
97 C A 0.0000
98 K A -0.4110
99 A A 0.0000
100 Q A -1.3881
101 T A 0.0000
102 E A -1.0161
103 G A 0.0000
104 P A 0.3466
105 I A 1.2480
106 A A 0.3342
107 D A -0.8210
108 W A 0.5456
109 G A 0.0610
110 T A -0.1245
111 S A -0.4340
112 Q A -1.5870
113 Y A -0.8214
114 E A -1.2475
115 Y A -0.1834
116 W A -0.3435
117 G A -0.8778
118 Q A -1.4741
119 G A -0.9914
120 T A -1.0369
121 Q A -0.9754
122 V A 0.0000
123 T A -0.2316
124 V A 0.0000
125 S A -0.6002
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018