Project name: b7265ab30dd6358

Status: done

Started: 2026-06-22 16:04:10
Settings
Chain sequence(s) B: SAELDKMIEDYEKAAKIAEEWAKKYPELKEHLEKFKEFMEKKKKELEEKK
input PDB
Selected Chain(s) B
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with B chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:02:57)
[INFO]       Main:     Simulation completed successfully.                                          (00:02:58)
Show buried residues

Minimal score value
-5.3626
Maximal score value
0.0
Average score
-2.9114
Total score value
-145.5707

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 S B -1.7106
2 A B -1.9717
3 E B -3.0632
4 L B -3.1432
5 D B -3.8175
6 K B -3.8730
7 M B -2.8885
8 I B -3.7994
9 E B -4.0388
10 D B -3.9159
11 Y B -2.8740
12 E B -3.5260
13 K B -3.0585
14 A B -1.8397
15 A B 0.0000
16 K B -2.3369
17 I B -0.0960
18 A B 0.0000
19 E B -2.3763
20 E B -1.9458
21 W B -1.2808
22 A B 0.0000
23 K B -2.8794
24 K B -2.6856
25 Y B -1.6434
26 P B -2.1873
27 E B -2.5603
28 L B -2.3084
29 K B -3.7126
30 E B -3.7557
31 H B -3.2736
32 L B -2.7591
33 E B -3.7106
34 K B -3.4017
35 F B -1.8158
36 K B -2.8817
37 E B -3.0061
38 F B -1.2172
39 M B -2.5291
40 E B -3.1102
41 K B -3.3677
42 K B -3.1476
43 K B -4.3815
44 K B -4.8587
45 E B -4.9250
46 L B -4.2493
47 E B -5.3626
48 E B -5.1213
49 K B -4.5633
50 K B -4.6001
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018