Project name: obj1 [mutate: KA65C, SD71C, NC74C, YG80C, SV85C, TI91C]

Chain sequence(s)	C: EVQLVESGGGLVQPGGSLRLSCAASDFTFRSYEMSWVRQAPGKGLEWVSAISGSGGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAIYYCARLRDGFNKGFDYWGQGTLVTVSS
Selected Chain(s)	C
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No
Mutated residues	YG80C,TI91C,SV85C,SD71C,KA65C,NC74C
Energy difference between WT (input) and mutated protein (by FoldX)	8.11285 kcal/mol CAUTION: Your mutation/s can destabilize the protein structure

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with C chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       FoldX:    Building mutant model                                                       (00:00:24)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:01:20)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:45)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:46)

• Minimal score value: -3.3333
• Maximal score value: 1.8478
• Average score: -0.5736
• Total score value: -68.831

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	E	C	-2.0063
2	V	C	-0.9169
3	Q	C	-1.2436
4	L	C	0.0000
5	V	C	0.5534
6	E	C	0.1720
7	S	C	-0.4661
8	G	C	-0.8574
9	G	C	0.0030
10	G	C	0.9809
11	L	C	1.5069
12	V	C	0.0392
13	Q	C	-1.1182
14	P	C	-1.0293
15	G	C	-0.5486
16	G	C	-0.3944
17	S	C	-0.6934
18	L	C	-0.6928
19	R	C	-2.1384
20	L	C	0.0000
21	S	C	-0.8390
22	C	C	0.0000
23	A	C	-0.2433
24	A	C	0.0000
25	S	C	-0.2028
26	D	C	0.0000
27	F	C	1.5444
28	T	C	0.3074
29	F	C	0.0000
30	R	C	-1.8473
31	S	C	-0.8277
32	Y	C	-1.2157
33	E	C	-1.1444
34	M	C	0.0000
35	S	C	0.0000
36	W	C	0.0000
37	V	C	0.0000
38	R	C	0.0000
39	Q	C	-0.2267
40	A	C	-0.8501
41	P	C	-1.2009
42	G	C	-1.4347
43	K	C	-2.1363
44	G	C	-1.0612
45	L	C	0.3896
46	E	C	-0.3994
47	W	C	0.3698
48	V	C	0.0000
49	S	C	0.0000
50	A	C	0.0000
51	I	C	0.0000
52	S	C	-0.7700
53	G	C	-1.1425
54	S	C	-1.2970
55	G	C	-1.4101
56	G	C	-0.9256
57	S	C	-0.4754
58	T	C	-0.0152
59	Y	C	0.9575
60	Y	C	0.4051
61	A	C	-0.5590
62	D	C	-1.7035
63	S	C	-1.2042
64	V	C	0.0000
65	A	C	-0.5589	mutated: KA65C
66	G	C	-0.5060
67	R	C	0.0000
68	F	C	0.0000
69	T	C	-0.7646
70	I	C	0.0000
71	D	C	-2.2012	mutated: SD71C
72	R	C	-2.0045
73	D	C	-1.9266
74	C	C	-1.7558	mutated: NC74C
75	S	C	-1.4865
76	K	C	-2.0945
77	N	C	-1.4054
78	T	C	-1.3259
79	L	C	0.0000
80	G	C	-1.4180	mutated: YG80C
81	L	C	0.0000
82	Q	C	-1.4088
83	M	C	0.0000
84	N	C	-0.3391
85	V	C	0.6605	mutated: SV85C
86	L	C	0.0000
87	R	C	-1.7773
88	A	C	-1.6678
89	E	C	-2.1338
90	D	C	0.0000
91	I	C	0.1045	mutated: TI91C
92	A	C	0.0000
93	I	C	1.1680
94	Y	C	0.0000
95	Y	C	0.6425
96	C	C	0.0000
97	A	C	0.0000
98	R	C	0.0000
99	L	C	0.0000
100	R	C	-3.1907
101	D	C	-3.3333
102	G	C	-2.0866
103	F	C	-1.2310
104	N	C	-2.4286
105	K	C	-3.1848
106	G	C	-1.9076
107	F	C	-0.9859
108	D	C	-1.0994
109	Y	C	-0.2104
110	W	C	0.5562
111	G	C	-0.0696
112	Q	C	-0.8817
113	G	C	0.1021
114	T	C	0.5697
115	L	C	1.8478
116	V	C	0.0000
117	T	C	0.5614
118	V	C	0.0000
119	S	C	-0.6721
120	S	C	-0.9791