Project name: query_structure

Status: done

Started: 2025-11-29 10:50:25
Settings
Chain sequence(s) A: ECLEIFKACNPSNDQCCKSSKLVCSRKTRWCKYQI
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:56)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:56)
Show buried residues

Minimal score value
-3.6491
Maximal score value
1.6152
Average score
-1.55
Total score value
-54.2499

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 E A -1.9910
2 C A -1.7860
3 L A -1.3861
4 E A -1.6915
5 I A 0.3613
6 F A 1.2267
7 K A -0.6578
8 A A -0.9625
9 C A -2.1705
10 N A -3.1967
11 P A -2.5437
12 S A -1.9259
13 N A -2.9758
14 D A -3.0998
15 Q A -2.9252
16 C A -1.9444
17 C A -1.9676
18 K A -2.5260
19 S A -1.7184
20 S A -1.5838
21 K A -2.1896
22 L A 0.0000
23 V A -0.7906
24 C A -1.7862
25 S A -2.1829
26 R A -3.6491
27 K A -3.1871
28 T A -2.0854
29 R A -3.1186
30 W A -1.5093
31 C A 0.0000
32 K A -0.4178
33 Y A 0.6008
34 Q A -0.0846
35 I A 1.6152
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018