Project name: obj1 [mutate: EA1C, LR4C, PY14C, LF20C, SQ21C, FN27C, TC28C, DM73C, SF85C, EH89C, RY98C, FV103C, FK107C, LC115C, TQ117C]

Chain sequence(s)	C: EVQLVESGGGLVQPGGSLRLSCAASDFTFRSYEMSWVRQAPGKGLEWVSAISGSGGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAIYYCARLRDGFNKGFDYWGQGTLVTVSS
Selected Chain(s)	C
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No
Mutated residues	LF20C,SQ21C,FN27C,FK107C,LC115C,EH89C,TC28C,SF85C,RY98C,FV103C,TQ117C,EA1C,LR4C,DM73C,PY14C
Energy difference between WT (input) and mutated protein (by FoldX)	23.7887 kcal/mol CAUTION: Your mutation/s can destabilize the protein structure

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with C chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       FoldX:    Building mutant model                                                       (00:00:25)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:03:35)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:04:08)
[INFO]       Main:     Simulation completed successfully.                                          (00:04:09)

• Minimal score value: -3.9864
• Maximal score value: 1.3975
• Average score: -0.5882
• Total score value: -70.5817

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	A	C	-0.2425	mutated: EA1C
2	V	C	-0.5810
3	Q	C	-0.6791
4	R	C	0.0000	mutated: LR4C
5	V	C	1.0698
6	E	C	0.2952
7	S	C	-0.3713
8	G	C	-0.7957
9	G	C	-0.2999
10	G	C	0.4188
11	L	C	1.1278
12	V	C	0.1280
13	Q	C	-0.4542
14	Y	C	0.5505	mutated: PY14C
15	G	C	0.3855
16	G	C	0.2629
17	S	C	-0.2091
18	L	C	-0.3446
19	R	C	-1.5797
20	F	C	0.0000	mutated: LF20C
21	Q	C	-0.7455	mutated: SQ21C
22	C	C	0.0000
23	A	C	-0.1063
24	A	C	0.0000
25	S	C	-0.6241
26	D	C	0.0000
27	N	C	-1.5528	mutated: FN27C
28	C	C	-1.0347	mutated: TC28C
29	F	C	0.0000
30	R	C	-2.2600
31	S	C	-1.1713
32	Y	C	-1.1182
33	E	C	-1.2587
34	M	C	0.0000
35	S	C	0.0000
36	W	C	0.0000
37	V	C	0.0000
38	R	C	0.0000
39	Q	C	-0.4545
40	A	C	-1.0547
41	P	C	-1.2110
42	G	C	-1.4376
43	K	C	-2.1487
44	G	C	-1.0974
45	L	C	0.2853
46	E	C	-0.4561
47	W	C	0.2958
48	V	C	0.0000
49	S	C	0.0000
50	A	C	0.0000
51	I	C	0.0000
52	S	C	-0.5828
53	G	C	-1.0636
54	S	C	-1.0319
55	G	C	-0.8921
56	G	C	-0.7327
57	S	C	-0.3426
58	T	C	0.1170
59	Y	C	0.4609
60	Y	C	-0.4262
61	A	C	-1.1619
62	D	C	-2.3365
63	S	C	-1.5692
64	V	C	0.0000
65	K	C	-2.3922
66	G	C	-1.3302
67	R	C	0.0000
68	F	C	0.0000
69	T	C	-0.6036
70	I	C	0.0000
71	S	C	-0.3915
72	R	C	-0.8390
73	M	C	-0.7441	mutated: DM73C
74	N	C	-1.5126
75	S	C	-1.3742
76	K	C	-1.9122
77	N	C	-1.7359
78	T	C	0.0000
79	L	C	0.0000
80	Y	C	0.0000
81	L	C	0.0000
82	Q	C	-1.0019
83	M	C	0.0000
84	N	C	0.1975
85	F	C	1.3975	mutated: SF85C
86	L	C	0.0000
87	R	C	-0.9264
88	A	C	-1.1391
89	H	C	-1.5092	mutated: EH89C
90	D	C	0.0000
91	T	C	-0.6128
92	A	C	0.0000
93	I	C	0.4415
94	Y	C	0.0000
95	Y	C	0.5679
96	C	C	0.0000
97	A	C	0.0000
98	Y	C	0.0000	mutated: RY98C
99	L	C	0.0000
100	R	C	-3.9864
101	D	C	-3.6540
102	G	C	-2.1700
103	V	C	-1.2985	mutated: FV103C
104	N	C	-2.5154
105	K	C	-3.5358
106	G	C	-2.6645
107	K	C	-2.7316	mutated: FK107C
108	D	C	-2.7386
109	Y	C	-0.7656
110	W	C	0.1738
111	G	C	0.1386
112	Q	C	-0.7482
113	G	C	-0.0041
114	T	C	0.1917
115	C	C	0.6840	mutated: LC115C
116	V	C	0.0000
117	Q	C	-0.4706	mutated: TQ117C
118	V	C	0.0000
119	S	C	-0.4410
120	S	C	-0.5943