Project name: query_structure

Status: done

Started: 2026-03-16 23:14:52
Settings
Chain sequence(s) A: EVQLQASGGGLVQTGGSLRLACAGSGRSFNNYGMGWFRQAPGKERQFVAAISGNDHTTHYSDSVKGRFTISRDNAKTTVYLQMNSLKPEDTAVYYCAADRLGSFFFPRASPSDYGYWGQGTQVTVS
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:15)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:15)
Show buried residues

Minimal score value
-3.3489
Maximal score value
2.9731
Average score
-0.8383
Total score value
-105.6258

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 E A -2.4000
2 V A -1.7187
3 Q A -2.0250
4 L A 0.0000
5 Q A -1.7921
6 A A -1.1134
7 S A -1.2200
8 G A -1.1048
9 G A -0.7540
10 G A -0.0255
11 L A 1.0704
12 V A 0.0340
13 Q A -1.2033
14 T A -1.3811
15 G A -1.3003
16 G A -0.8679
17 S A -1.2591
18 L A -1.0921
19 R A -2.2319
20 L A 0.0000
21 A A -0.8350
22 C A 0.0000
23 A A -1.0400
24 G A 0.0000
25 S A -1.7567
26 G A -2.0318
27 R A -2.4546
28 S A -1.7228
29 F A 0.0000
30 N A -2.0049
31 N A -2.0110
32 Y A -1.0440
33 G A 0.0000
34 M A 0.0000
35 G A 0.0000
36 W A 0.0000
37 F A 0.0000
38 R A -1.1505
39 Q A -1.8461
40 A A -1.8570
41 P A -1.3399
42 G A -1.9141
43 K A -3.2484
44 E A -3.3489
45 R A -2.3646
46 Q A -1.7251
47 F A -0.7711
48 V A 0.0000
49 A A 0.0000
50 A A 0.0000
51 I A 0.0000
52 S A 0.0000
53 G A 0.0000
54 N A -2.7723
55 D A -2.9364
56 H A -2.0853
57 T A -1.2428
58 T A -0.5263
59 H A -0.6371
60 Y A -0.9611
61 S A -1.4201
62 D A -2.4436
63 S A -1.7311
64 V A 0.0000
65 K A -2.6335
66 G A -1.7534
67 R A -1.3749
68 F A 0.0000
69 T A -0.9730
70 I A 0.0000
71 S A -0.4836
72 R A 0.0000
73 D A -1.4876
74 N A -1.7841
75 A A -1.3099
76 K A -2.0796
77 T A -1.4265
78 T A -1.1302
79 V A 0.0000
80 Y A -0.6407
81 L A 0.0000
82 Q A -1.5421
83 M A 0.0000
84 N A -1.3591
85 S A -1.1394
86 L A 0.0000
87 K A -2.1188
88 P A -1.8244
89 E A -2.2873
90 D A 0.0000
91 T A -0.8765
92 A A 0.0000
93 V A -0.3597
94 Y A 0.0000
95 Y A -0.5319
96 C A 0.0000
97 A A 0.0000
98 A A 0.0000
99 D A 0.0000
100 R A -1.7621
101 L A 0.4838
102 G A -0.3053
103 S A 0.4844
104 F A 2.9731
105 F A 2.9380
106 F A 1.4368
107 P A 0.4073
108 R A -0.0180
109 A A -0.3509
110 S A -0.6112
111 P A -0.6511
112 S A -0.7097
113 D A -1.0888
114 Y A 0.0000
115 G A -0.7693
116 Y A -0.5844
117 W A -0.2594
118 G A -1.0230
119 Q A -1.5131
120 G A -1.0043
121 T A -1.0581
122 Q A -0.9712
123 V A 0.0000
124 T A -0.2328
125 V A 0.0000
126 S A -0.7129
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018