Project name: obj1 [mutate: QA112C, GD113C, LD115C, TH117C]

Chain sequence(s)	C: EVQLVESGGGLVQPGGSLRLSCAASDFTFRSYEMSWVRQAPGKGLEWVSAISGSGGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAIYYCARLRDGFNKGFDYWGQGTLVTVSS
Selected Chain(s)	C
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No
Mutated residues	TH117C,LD115C,GD113C,QA112C
Energy difference between WT (input) and mutated protein (by FoldX)	10.7776 kcal/mol CAUTION: Your mutation/s can destabilize the protein structure

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with C chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       FoldX:    Building mutant model                                                       (00:00:25)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:46)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:10)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:11)

• Minimal score value: -3.3328
• Maximal score value: 1.5458
• Average score: -0.7521
• Total score value: -90.2502

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	E	C	-2.0063
2	V	C	-0.9194
3	Q	C	-1.0905
4	L	C	0.0000
5	V	C	0.7299
6	E	C	-0.0321
7	S	C	-0.7076
8	G	C	-1.1612
9	G	C	-0.8929
10	G	C	0.1535
11	L	C	0.9404
12	V	C	-0.1248
13	Q	C	-1.4024
14	P	C	-1.5347
15	G	C	-1.4133
16	G	C	-0.9781
17	S	C	-1.2307
18	L	C	-0.9467
19	R	C	-2.1405
20	L	C	0.0000
21	S	C	-0.5382
22	C	C	0.0000
23	A	C	-0.2021
24	A	C	0.0000
25	S	C	-0.2018
26	D	C	0.0000
27	F	C	1.5458
28	T	C	0.2525
29	F	C	0.0000
30	R	C	-2.0325
31	S	C	-0.8863
32	Y	C	-1.2160
33	E	C	-1.1451
34	M	C	0.0000
35	S	C	0.0000
36	W	C	0.0000
37	V	C	0.0000
38	R	C	0.0000
39	Q	C	-0.7554
40	A	C	-1.3257
41	P	C	-1.2971
42	G	C	-1.4381
43	K	C	-2.1468
44	G	C	-1.0951
45	L	C	0.3006
46	E	C	-0.4286
47	W	C	0.3224
48	V	C	0.0000
49	S	C	0.0000
50	A	C	0.0000
51	I	C	0.0000
52	S	C	-0.5831
53	G	C	-1.2447
54	S	C	-1.2286
55	G	C	-1.0817
56	G	C	-0.7345
57	S	C	-0.3025
58	T	C	0.1989
59	Y	C	0.6077
60	Y	C	-0.3559
61	A	C	-1.1386
62	D	C	-2.3443
63	S	C	-1.7150
64	V	C	0.0000
65	K	C	-2.3847
66	G	C	-1.6175
67	R	C	0.0000
68	F	C	0.0000
69	T	C	-0.6722
70	I	C	0.0000
71	S	C	-0.5624
72	R	C	-1.3626
73	D	C	-1.9805
74	N	C	-2.1901
75	S	C	-1.7905
76	K	C	-2.3163
77	N	C	-1.6492
78	T	C	0.0000
79	L	C	0.0000
80	Y	C	-0.6697
81	L	C	0.0000
82	Q	C	-1.2337
83	M	C	0.0000
84	N	C	-1.3327
85	S	C	-1.2322
86	L	C	0.0000
87	R	C	-2.5217
88	A	C	-1.9713
89	E	C	-2.3972
90	D	C	0.0000
91	T	C	-1.0476
92	A	C	0.0000
93	I	C	-0.3055
94	Y	C	0.0000
95	Y	C	0.1936
96	C	C	0.0000
97	A	C	0.0000
98	R	C	0.0000
99	L	C	0.0000
100	R	C	-3.1896
101	D	C	-3.3328
102	G	C	-2.0863
103	F	C	-1.2307
104	N	C	-2.4282
105	K	C	-3.1842
106	G	C	-1.9062
107	F	C	-0.9872
108	D	C	-1.1028
109	Y	C	-0.2204
110	W	C	0.6919
111	G	C	0.2578
112	A	C	-0.0440	mutated: QA112C
113	D	C	-0.7540	mutated: GD113C
114	T	C	-0.8466
115	D	C	-1.1790	mutated: LD115C
116	V	C	0.0000
117	H	C	-0.6950	mutated: TH117C
118	V	C	0.0000
119	S	C	-0.8896
120	S	C	-1.1121