Project name: Colicin

Status: done

Started: 2026-04-12 14:38:35
Settings
Chain sequence(s) A: NLKKAQNNLLNSQIKDAVDATVSFYQTLTEKYGEKYSKMAQELADKSKGKKIGNVNEALAAFEKYKDVLNKKFSKADRDAIFNALASVKYDDWAKHLDQFAKYLKITGHVSFGYDVVSDILKIKDTGDWKPLFLTLEKKAADAGVSYVVALLFSLLAGTTLGIWGIAIVTGILCSYIDKNKLNTINEVLGI
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:05:31)
[INFO]       Main:     Simulation completed successfully.                                          (00:05:32)
Show buried residues

Minimal score value
-3.5617
Maximal score value
1.2409
Average score
-1.1496
Total score value
-219.5777

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 N A -1.6981
2 L A -0.8446
3 K A -2.8736
4 K A -3.1897
5 A A -2.0551
6 Q A -2.3493
7 N A -2.5609
8 N A -2.0483
9 L A -0.1495
10 L A -0.3016
11 N A -1.2901
12 S A -1.2950
13 Q A -1.4642
14 I A -0.4059
15 K A -2.0810
16 D A -2.6797
17 A A 0.0000
18 V A 0.2510
19 D A -1.4587
20 A A -0.8701
21 T A 0.0772
22 V A 1.2409
23 S A 0.2106
24 F A 0.0000
25 Y A -0.4957
26 Q A -1.0449
27 T A -0.8548
28 L A 0.0000
29 T A -2.5187
30 E A -2.6528
31 K A -1.9167
32 Y A -1.4153
33 G A -2.4234
34 E A -3.5617
35 K A -3.3743
36 Y A 0.0000
37 S A 0.0000
38 K A -3.3159
39 M A 0.0000
40 A A 0.0000
41 Q A -2.5342
42 E A -2.7481
43 L A 0.0000
44 A A 0.0000
45 D A -2.5398
46 K A -2.5870
47 S A 0.0000
48 K A -2.8405
49 G A -2.5387
50 K A -2.6262
51 K A -2.9938
52 I A 0.0000
53 G A -2.2279
54 N A -2.7560
55 V A 0.0000
56 N A -2.6998
57 E A -3.1778
58 A A 0.0000
59 L A 0.0000
60 A A -1.9335
61 A A 0.0000
62 F A 0.0000
63 E A -2.7221
64 K A -2.5627
65 Y A -1.7513
66 K A -2.1165
67 D A -2.9875
68 V A -1.3828
69 L A 0.0000
70 N A -2.6425
71 K A -2.9098
72 K A -2.4828
73 F A -1.6296
74 S A -2.0547
75 K A -2.6265
76 A A -1.4226
77 D A -1.8381
78 R A -1.8861
79 D A -1.6466
80 A A -1.0843
81 I A -0.4558
82 F A -0.7184
83 N A -1.0708
84 A A -0.5748
85 L A 0.0000
86 A A -0.4846
87 S A -0.7339
88 V A -1.1580
89 K A -2.3836
90 Y A -1.5365
91 D A -2.9234
92 D A -3.0277
93 W A 0.0000
94 A A -2.3873
95 K A -3.4887
96 H A -2.3538
97 L A 0.0000
98 D A -3.1594
99 Q A -2.9140
100 F A 0.0000
101 A A 0.0000
102 K A -2.2047
103 Y A -1.1912
104 L A 0.0000
105 K A -2.1550
106 I A -1.8148
107 T A -1.2448
108 G A -1.4471
109 H A -1.3684
110 V A -0.9150
111 S A -0.6046
112 F A 0.2354
113 G A 0.1816
114 Y A 0.5545
115 D A -0.7934
116 V A 0.0000
117 V A 0.0000
118 S A -0.2159
119 D A 0.0000
120 I A -0.6648
121 L A -0.7088
122 K A -2.3314
123 I A 0.0000
124 K A -3.0775
125 D A -3.2392
126 T A -2.3674
127 G A -2.3575
128 D A -2.6923
129 W A -1.6324
130 K A -1.6634
131 P A -1.0480
132 L A 0.0000
133 F A 0.0000
134 L A -0.6116
135 T A 0.0000
136 L A 0.0000
137 E A -1.9356
138 K A -2.2132
139 K A -1.6865
140 A A 0.0000
141 A A -1.9013
142 D A -2.4523
143 A A -1.8924
144 G A 0.0000
145 V A 0.0000
146 S A 0.0000
147 Y A 0.0000
148 V A 0.0000
149 V A 0.0000
150 A A 0.0000
151 L A 0.0000
152 L A 0.0000
153 F A 0.0000
154 S A 0.0000
155 L A 0.0000
156 L A 0.0000
157 A A 0.0000
158 G A -1.1499
159 T A 0.0000
160 T A -0.1894
161 L A 0.0000
162 G A -0.1085
163 I A 0.7923
164 W A 0.0000
165 G A 0.0000
166 I A 0.0000
167 A A 0.0000
168 I A 0.0000
169 V A 0.0000
170 T A 0.0000
171 G A 0.0000
172 I A 0.0000
173 L A 0.0000
174 C A 0.0000
175 S A 0.0000
176 Y A 0.0000
177 I A 0.0000
178 D A -1.6535
179 K A -2.5201
180 N A -2.4647
181 K A -1.9048
182 L A -1.8967
183 N A -2.1811
184 T A -1.7298
185 I A 0.0000
186 N A -1.2793
187 E A -2.2060
188 V A -1.7154
189 L A -0.4787
190 G A -0.6033
191 I A -0.0994
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018