Project name: query_structure

Status: done

Started: 2026-03-16 23:36:39
Settings
Chain sequence(s) A: GSSVSSVPTKLEVVAATPTSLLISWDASSSSVSHYEITYGETGGNSPVQEFTVPGSSSTATISGLSPGVDYTITVAAYHSYHDIFYAVSPSSINYRT
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:22)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:22)
Show buried residues

Minimal score value
-2.5534
Maximal score value
3.0624
Average score
-0.282
Total score value
-27.3558

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 G A -0.4340
2 S A -0.1661
3 S A 0.3704
4 V A 1.4903
5 S A 0.6355
6 S A 0.2557
7 V A -0.0556
8 P A 0.0000
9 T A -1.5392
10 K A -2.5534
11 L A -1.5759
12 E A -1.6215
13 V A 0.2585
14 V A 1.6166
15 A A 0.9225
16 A A 0.2977
17 T A -0.3832
18 P A -0.8285
19 T A -0.5483
20 S A -0.3146
21 L A 0.0000
22 L A 0.7704
23 I A 0.0000
24 S A -0.6588
25 W A 0.0000
26 D A -2.4974
27 A A -1.1822
28 S A -0.7692
29 S A -0.6196
30 S A -0.4286
31 S A -0.2054
32 V A 0.2821
33 S A 0.2596
34 H A -0.2128
35 Y A 0.0000
36 E A -0.7666
37 I A 0.0000
38 T A -0.5973
39 Y A -0.2578
40 G A 0.0000
41 E A -1.3740
42 T A -1.2500
43 G A -1.3494
44 G A -1.2601
45 N A -1.6859
46 S A -0.8420
47 P A -0.2837
48 V A 0.4710
49 Q A -0.7895
50 E A -1.6103
51 F A -0.5983
52 T A -0.3731
53 V A -0.1199
54 P A -0.4143
55 G A -0.4515
56 S A -0.4219
57 S A -0.4608
58 S A -0.6554
59 T A -0.2171
60 A A 0.0000
61 T A 0.2496
62 I A 0.0000
63 S A -0.4721
64 G A -0.6846
65 L A 0.0000
66 S A -0.8486
67 P A -1.0228
68 G A -1.1082
69 V A -0.9511
70 D A -1.6818
71 Y A -0.9830
72 T A -0.6933
73 I A 0.0000
74 T A -0.5157
75 V A 0.0000
76 A A 0.0000
77 A A 0.0000
78 Y A 1.2586
79 H A 1.2415
80 S A 1.2140
81 Y A 1.4747
82 H A -0.4317
83 D A -0.5037
84 I A 2.1602
85 F A 3.0624
86 Y A 2.6449
87 A A 1.3412
88 V A 0.8430
89 S A 0.1402
90 P A -0.1776
91 S A -0.4562
92 S A -0.6250
93 I A -0.6656
94 N A -1.6126
95 Y A -1.3413
96 R A -2.2923
97 T A -1.1760
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018