Project name: query_structure

Status: done

Started: 2026-03-16 21:21:17
Settings
Chain sequence(s) A: MHSFCAFKADDGPCRARFDRWFFNIFTRQCEEFIYGGCEGNQNRFESLEECKKMCTRD
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:18)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:19)
Show buried residues

Minimal score value
-3.4291
Maximal score value
1.6077
Average score
-1.4462
Total score value
-83.879

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 M A 0.0490
2 H A -0.2021
3 S A 0.2670
4 F A 0.5503
5 C A 0.0000
6 A A 0.6343
7 F A 0.2569
8 K A -1.5373
9 A A -1.8611
10 D A -2.4941
11 D A -3.0612
12 G A -2.2090
13 P A -1.5019
14 C A -1.6499
15 R A -2.3170
16 A A -1.8434
17 R A -2.3169
18 F A -1.3913
19 D A -2.4504
20 R A -2.2863
21 W A -2.0194
22 F A -1.2813
23 F A 0.0000
24 N A -0.4392
25 I A 0.8845
26 F A 1.6077
27 T A -0.1720
28 R A -1.5144
29 Q A -2.0279
30 C A -1.9425
31 E A -1.7302
32 E A -2.5219
33 F A -1.5461
34 I A -1.4760
35 Y A 0.0000
36 G A 0.0000
37 G A -1.5048
38 C A -1.5363
39 E A -2.5436
40 G A -2.5500
41 N A -1.7877
42 Q A -1.6331
43 N A 0.0000
44 R A -2.0520
45 F A 0.0000
46 E A -2.7399
47 S A -2.4951
48 L A -2.1351
49 E A -3.1751
50 E A -2.9750
51 C A 0.0000
52 K A -3.4291
53 K A -3.4005
54 M A -1.5720
55 C A 0.0000
56 T A -2.8399
57 R A -2.9588
58 D A -3.0079
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018