Project name: query_structure

Status: done

Started: 2026-03-17 01:21:09
Settings
Chain sequence(s) A: VSSVPTKLEVVAATPTSLLISWDAPAVTVDFYVITYGETGGNSPVQEFTVPGSKSTATISGLKPGVDYTITVYAYVSYPEYYFPSPISIYRT
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:04)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:05)
Show buried residues

Minimal score value
-2.3936
Maximal score value
2.8144
Average score
-0.2247
Total score value
-20.6684

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 V A 1.7572
2 S A 0.7604
3 S A 0.9920
4 V A 0.5443
5 P A 0.0000
6 T A -1.2635
7 K A -2.3936
8 L A -1.1602
9 E A -1.5354
10 V A 0.0370
11 V A 1.5483
12 A A 0.8889
13 A A 0.5067
14 T A -0.3547
15 P A -0.8896
16 T A -0.9945
17 S A -0.5550
18 L A 0.0000
19 L A 0.7257
20 I A 0.0000
21 S A -0.8619
22 W A 0.0000
23 D A -2.2733
24 A A -1.1006
25 P A 0.0253
26 A A 0.3409
27 V A 0.4897
28 T A -0.0933
29 V A 0.0000
30 D A -0.9721
31 F A -0.2773
32 Y A 0.0000
33 V A 0.1421
34 I A 0.0000
35 T A -0.1874
36 Y A 0.0527
37 G A 0.0000
38 E A -1.5756
39 T A -1.3814
40 G A -1.2952
41 G A -1.4084
42 N A -1.5145
43 S A -0.8069
44 P A -0.2942
45 V A 0.4882
46 Q A -0.7928
47 E A -1.4846
48 F A -0.5044
49 T A 0.0334
50 V A 0.0000
51 P A -0.8550
52 G A -0.9590
53 S A -1.2866
54 K A -1.9834
55 S A -1.2733
56 T A -0.7143
57 A A 0.0000
58 T A 0.2321
59 I A 0.0000
60 S A -0.6750
61 G A -1.0449
62 L A 0.0000
63 K A -2.2287
64 P A -1.4266
65 G A -1.1109
66 V A -1.4214
67 D A -2.3777
68 Y A 0.0000
69 T A -0.3232
70 I A 0.0000
71 T A 0.0000
72 V A 0.0000
73 Y A 1.0284
74 A A 0.0000
75 Y A 0.9542
76 V A 0.9048
77 S A 0.4541
78 Y A 0.6922
79 P A -0.3906
80 E A -0.7045
81 Y A 1.6258
82 Y A 2.5898
83 F A 2.8144
84 P A 1.6442
85 S A 0.0000
86 P A 1.1793
87 I A 1.6267
88 S A 0.6870
89 I A 1.2985
90 Y A -0.1482
91 R A -1.7084
92 T A -1.1306
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018