Project name: query_structure

Status: done

Started: 2026-03-16 22:49:05
Settings
Chain sequence(s) A: VSSVPTKLEVVAATPTSLLVSWDAPAVTVVFYDITYGETGGNSPVQEFTVPGSKSTATISGLKPGVDYTITVYAKYLFWSGYSSPISINYRTEIDK
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:46)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:47)
Show buried residues

Minimal score value
-2.7111
Maximal score value
2.979
Average score
-0.3993
Total score value
-38.3344

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 V A 1.7698
2 S A 0.7816
3 S A 0.6055
4 V A 0.3118
5 P A 0.0000
6 T A -1.5000
7 K A -2.4943
8 L A -1.6171
9 E A -1.8416
10 V A 0.0855
11 V A 1.5243
12 A A 0.8674
13 A A -0.0689
14 T A -0.8263
15 P A -1.9592
16 T A -1.2577
17 S A -0.7038
18 L A 0.0000
19 L A 0.6934
20 V A 0.0000
21 S A -0.8781
22 W A 0.0000
23 D A -2.3882
24 A A -1.1313
25 P A 0.0332
26 A A 0.3947
27 V A 0.6994
28 T A 0.7282
29 V A 0.7644
30 V A 1.2418
31 F A 0.7566
32 Y A 0.0000
33 D A 0.0000
34 I A 0.0000
35 T A -0.4541
36 Y A -0.3184
37 G A 0.0000
38 E A -1.4726
39 T A -1.2054
40 G A -1.2117
41 G A -1.3719
42 N A -1.5177
43 S A -0.8126
44 P A -0.3189
45 V A 0.4219
46 Q A -0.8938
47 E A -1.5923
48 F A -0.6108
49 T A -0.0675
50 V A 0.0000
51 P A -0.3676
52 G A -0.3397
53 S A -0.8606
54 K A -1.8986
55 S A -1.2498
56 T A -0.7282
57 A A 0.0000
58 T A 0.2202
59 I A 0.0000
60 S A -0.6429
61 G A -0.9925
62 L A 0.0000
63 K A -2.4569
64 P A -2.0968
65 G A -1.6287
66 V A -1.2294
67 D A -2.1391
68 Y A 0.0000
69 T A -0.7672
70 I A 0.0000
71 T A -0.0981
72 V A 0.0000
73 Y A 0.5631
74 A A 0.0000
75 K A 0.6510
76 Y A 0.0000
77 L A 2.7396
78 F A 2.9790
79 W A 2.1471
80 S A 0.9658
81 G A 0.8109
82 Y A 0.9949
83 S A 0.0000
84 S A 0.1094
85 P A 0.2920
86 I A 0.0710
87 S A -0.3568
88 I A -0.9043
89 N A -1.7367
90 Y A -1.6756
91 R A -2.6080
92 T A 0.0000
93 E A -2.6557
94 I A -1.4572
95 D A -2.7111
96 K A -2.4422
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018