Project name: 8e550b83b008968 [mutate: IA1A] [mutate: YF4A] [mutate: FW4A] [mutate: YF67A] [mutate: FH67A] [mutate: YF123A] [mutate: FL123A] [mutate: LW123A] [mutate: WA123A] [mutate: VA150A, IA148A, GA151A] [mutate: HY67A] [mutate: YF67A]

Status: done

Started: 2026-07-17 18:40:53
Settings
Chain sequence(s) A: APEWVDWRQKGAVTPVKNQGSCGSCWAFSAVVTIEGIIKIRTGNLNQYSEQELLDCDRRSYGCNGGYPWSALQLVAQYGIHYRNTYPYEGVQRYCRSREKGPYAAKTDGVRQVQPYNQGALLASIANQPVSVVLQAAGKDFQLYRGGAFAAPCGNKVDHAVAAVGYGPNYILIKNSWGTGWGENGYIRIKRGTGNSYGVCGLYTSSFYPVKN
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Mutated residues YF67A
Energy difference between WT (input) and mutated protein (by FoldX) -0.0493305 kcal/mol
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       FoldX:    Building mutant model                                                       (00:00:46)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:49)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:38)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:39)
Show buried residues

Minimal score value
-3.5602
Maximal score value
0.8475
Average score
-0.763
Total score value
-161.7466

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 A A -0.4355
2 P A -0.8068
3 E A -1.5171
4 W A -0.1361
5 V A 0.0000
6 D A -1.7112
7 W A -1.7953
8 R A -2.4984
9 Q A -2.7807
10 K A -2.8517
11 G A -1.8086
12 A A 0.0000
13 V A -0.7804
14 T A 0.0000
15 P A -0.3435
16 V A -0.4343
17 K A -0.8435
18 N A -1.5610
19 Q A -1.1706
20 G A -1.1991
21 S A -0.6802
22 C A 0.0000
23 G A -0.7430
24 S A 0.0000
25 C A -0.3767
26 W A 0.0000
27 A A 0.0000
28 F A 0.0000
29 S A 0.0000
30 A A 0.0000
31 V A 0.0000
32 V A 0.0000
33 T A 0.0000
34 I A 0.0000
35 E A 0.0000
36 G A 0.0000
37 I A 0.0000
38 I A 0.0000
39 K A -1.3221
40 I A -1.2565
41 R A -2.3501
42 T A -1.6542
43 G A -1.5596
44 N A -1.6160
45 L A -0.3495
46 N A -0.4706
47 Q A -0.6781
48 Y A 0.0000
49 S A 0.0000
50 E A 0.0000
51 Q A 0.0000
52 E A 0.0000
53 L A 0.0000
54 L A 0.0000
55 D A 0.0000
56 C A 0.0000
57 D A 0.0000
58 R A -2.3448
59 R A -2.3298
60 S A 0.0000
61 Y A -0.0643
62 G A 0.0000
63 C A -0.6460
64 N A -1.0753
65 G A -0.5879
66 G A -0.2188
67 F A 0.8475 mutated: YF67A
68 P A 0.0000
69 W A 0.2433
70 S A 0.0000
71 A A 0.0000
72 L A 0.0000
73 Q A -0.9968
74 L A 0.0000
75 V A 0.0000
76 A A -1.5077
77 Q A -1.5006
78 Y A -0.4921
79 G A 0.0000
80 I A 0.0000
81 H A 0.0000
82 Y A -0.1603
83 R A -0.9135
84 N A -1.3934
85 T A -0.8721
86 Y A 0.0000
87 P A -1.1775
88 Y A -1.3148
89 E A -1.9862
90 G A -1.2834
91 V A -0.7780
92 Q A -1.4104
93 R A -1.6028
94 Y A -0.0181
95 C A -1.0683
96 R A -2.3020
97 S A 0.0000
98 R A -3.2376
99 E A -3.5602
100 K A -2.7765
101 G A -1.9835
102 P A -0.9285
103 Y A -0.2180
104 A A -0.0062
105 A A 0.0000
106 K A -1.6049
107 T A 0.0000
108 D A -2.4949
109 G A -1.7020
110 V A -1.2021
111 R A -2.2177
112 Q A -2.1494
113 V A -1.4976
114 Q A -1.8027
115 P A -0.7459
116 Y A -0.2172
117 N A -1.1866
118 Q A -1.0718
119 G A -0.9097
120 A A -0.6903
121 L A 0.0000
122 L A -0.3124
123 A A -0.3271
124 S A 0.0000
125 I A 0.0000
126 A A -0.5867
127 N A -1.2206
128 Q A -0.5965
129 P A 0.0000
130 V A 0.0000
131 S A 0.0000
132 V A 0.0000
133 V A 0.0000
134 L A 0.0000
135 Q A -1.2706
136 A A 0.0000
137 A A -1.1780
138 G A -1.7343
139 K A -2.3974
140 D A -2.2340
141 F A 0.0000
142 Q A -1.6913
143 L A -0.8151
144 Y A 0.0000
145 R A -2.8794
146 G A -2.3288
147 G A -1.4484
148 A A -0.7869
149 F A 0.0000
150 A A -0.4279
151 A A -0.5582
152 P A -0.6048
153 C A -0.9282
154 G A -1.0882
155 N A -1.9996
156 K A -2.4422
157 V A -1.3780
158 D A -1.5792
159 H A 0.0000
160 A A 0.0000
161 V A 0.0000
162 A A 0.0000
163 A A 0.0000
164 V A 0.0000
165 G A 0.0000
166 Y A 0.0000
167 G A 0.0000
168 P A -1.1890
169 N A -1.8526
170 Y A -1.0819
171 I A 0.0000
172 L A 0.0000
173 I A 0.0000
174 K A 0.0000
175 N A 0.0000
176 S A 0.0000
177 W A -0.8438
178 G A -1.0691
179 T A -1.6296
180 G A -1.6263
181 W A 0.0000
182 G A -2.5255
183 E A -3.3959
184 N A -2.6310
185 G A 0.0000
186 Y A 0.0000
187 I A 0.0000
188 R A -1.4711
189 I A 0.0000
190 K A -1.5772
191 R A -1.6090
192 G A -1.5070
193 T A -1.1864
194 G A -1.0878
195 N A -1.1675
196 S A -0.6013
197 Y A -0.0043
198 G A 0.0000
199 V A -0.4570
200 C A 0.0000
201 G A 0.0000
202 L A 0.0000
203 Y A 0.0000
204 T A -0.2696
205 S A -0.2171
206 S A 0.0000
207 F A 0.0000
208 Y A 0.0000
209 P A 0.0000
210 V A -1.1183
211 K A -1.8283
212 N A -2.0984
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018