Project name: obj1 [mutate: SC120C, VP2C, VS5C, SD7C]

Chain sequence(s)	C: EVQLVESGGGLVQPGGSLRLSCAASDFTFRSYEMSWVRQAPGKGLEWVSAISGSGGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAIYYCARLRDGFNKGFDYWGQGTLVTVSS
Selected Chain(s)	C
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No
Mutated residues	VP2C,SC120C,SD7C,VS5C
Energy difference between WT (input) and mutated protein (by FoldX)	7.41225 kcal/mol CAUTION: Your mutation/s can destabilize the protein structure

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with C chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       FoldX:    Building mutant model                                                       (00:00:24)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:37)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:00)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:00)

• Minimal score value: -3.3342
• Maximal score value: 1.5825
• Average score: -0.735
• Total score value: -88.2023

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	E	C	-2.1315
2	P	C	-1.1791	mutated: VP2C
3	Q	C	-1.7003
4	L	C	0.0000
5	S	C	-1.2470	mutated: VS5C
6	E	C	-1.2540
7	D	C	-2.3243	mutated: SD7C
8	G	C	-1.5109
9	G	C	-0.3400
10	G	C	0.7697
11	L	C	1.4409
12	V	C	0.0596
13	Q	C	-1.1502
14	P	C	-1.2608
15	G	C	-1.4121
16	G	C	-0.9774
17	S	C	-1.2305
18	L	C	-0.9456
19	R	C	-2.3439
20	L	C	0.0000
21	S	C	-1.3445
22	C	C	0.0000
23	A	C	-0.9767
24	A	C	0.0000
25	S	C	-0.4670
26	D	C	0.0000
27	F	C	1.5019
28	T	C	0.2096
29	F	C	0.0000
30	R	C	-2.0376
31	S	C	-0.8917
32	Y	C	-1.2202
33	E	C	-1.1477
34	M	C	0.0000
35	S	C	0.0000
36	W	C	0.0000
37	V	C	0.0000
38	R	C	0.0000
39	Q	C	-0.2966
40	A	C	-0.9843
41	P	C	-1.2937
42	G	C	-1.4348
43	K	C	-2.1350
44	G	C	-1.0592
45	L	C	0.3948
46	E	C	-0.3909
47	W	C	0.3405
48	V	C	0.0000
49	S	C	0.0000
50	A	C	0.0000
51	I	C	0.0000
52	S	C	-0.5842
53	G	C	-1.2470
54	S	C	-1.2288
55	G	C	-1.0819
56	G	C	-0.7345
57	S	C	-0.3027
58	T	C	0.1987
59	Y	C	0.6074
60	Y	C	-0.3559
61	A	C	-1.1386
62	D	C	-2.3443
63	S	C	-1.7150
64	V	C	0.0000
65	K	C	-2.3847
66	G	C	-1.6175
67	R	C	0.0000
68	F	C	0.0000
69	T	C	-0.6729
70	I	C	0.0000
71	S	C	-0.5637
72	R	C	-1.3636
73	D	C	-1.9811
74	N	C	-2.1918
75	S	C	-1.7905
76	K	C	-2.3149
77	N	C	-1.6479
78	T	C	0.0000
79	L	C	0.0000
80	Y	C	-0.8496
81	L	C	0.0000
82	Q	C	-1.2345
83	M	C	0.0000
84	N	C	-1.3323
85	S	C	-1.2315
86	L	C	0.0000
87	R	C	-2.2894
88	A	C	-1.5674
89	E	C	-2.2127
90	D	C	0.0000
91	T	C	-0.3257
92	A	C	0.0000
93	I	C	1.0770
94	Y	C	0.0000
95	Y	C	0.4494
96	C	C	0.0000
97	A	C	0.0000
98	R	C	0.0000
99	L	C	0.0000
100	R	C	-3.1918
101	D	C	-3.3342
102	G	C	-2.0882
103	F	C	-1.2339
104	N	C	-2.4298
105	K	C	-3.1855
106	G	C	-1.9084
107	F	C	-0.9871
108	D	C	-1.1321
109	Y	C	-0.2722
110	W	C	0.3276
111	G	C	-0.5700
112	Q	C	-1.4220
113	G	C	-0.4085
114	T	C	-0.0080
115	L	C	1.5825
116	V	C	0.0000
117	T	C	0.4405
118	V	C	0.0000
119	S	C	-0.3229
120	C	C	-0.1157	mutated: SC120C