Project name: b9672415cfc85c0

Chain sequence(s)	A: MRVLYLLFSFLFIFLMPLPGVFGGIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKPEAAKPEEELVKANSWNQFLQSGKKVPNIVRNDEHPQHYFQEGPGPGTPSIQAIVPLLVPEEGPGPGHTPSIQAIVPLLVPEAAYRVKVKSMSKGPGPGFLISGILSL
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:02:34)
[INFO]       Main:     Simulation completed successfully.                                          (00:02:36)

• Minimal score value: -4.0071
• Maximal score value: 5.8068
• Average score: 0.1997
• Total score value: 34.1415

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	M	A	1.3920
2	R	A	0.5603
3	V	A	2.7540
4	L	A	3.3539
5	Y	A	3.3862
6	L	A	3.5531
7	L	A	4.0282
8	F	A	4.6125
9	S	A	4.4833
10	F	A	5.4585
11	L	A	5.3560
12	F	A	5.7270
13	I	A	5.8068
14	F	A	5.5325
15	L	A	4.7686
16	M	A	3.6442
17	P	A	1.9544
18	L	A	2.4667
19	P	A	1.0069
20	G	A	1.2921
21	V	A	2.4833
22	F	A	2.2492
23	G	A	0.7700
24	G	A	0.3644
25	I	A	0.2837
26	G	A	-0.0453
27	D	A	-0.4598
28	P	A	0.5911
29	V	A	1.4119
30	T	A	0.1937
31	C	A	0.0000
32	L	A	1.2164
33	K	A	-0.7152
34	S	A	-0.2341
35	G	A	-0.6162
36	A	A	0.0000
37	I	A	0.5176
38	C	A	0.8822
39	H	A	0.3105
40	P	A	0.8956
41	V	A	2.0013
42	F	A	1.5450
43	C	A	-0.3973
44	P	A	-1.4291
45	R	A	-2.8432
46	R	A	-3.2963
47	Y	A	-2.6452
48	K	A	-2.8051
49	Q	A	-1.6332
50	I	A	-0.6265
51	G	A	-0.4804
52	T	A	-0.4170
53	C	A	0.0000
54	G	A	-0.1814
55	L	A	0.7559
56	P	A	0.2620
57	G	A	0.3346
58	T	A	0.4249
59	K	A	-0.1707
60	C	A	0.0000
61	C	A	0.0000
62	K	A	-1.7885
63	K	A	-2.9895
64	P	A	-2.4598
65	E	A	-2.5412
66	A	A	-1.5791
67	A	A	-2.1125
68	K	A	-3.2268
69	P	A	-2.6592
70	E	A	-3.2319
71	E	A	-3.5308
72	E	A	-3.2105
73	L	A	-1.0461
74	V	A	-0.7017
75	K	A	-2.4415
76	A	A	-1.5641
77	N	A	-1.6556
78	S	A	-1.1450
79	W	A	-0.3767
80	N	A	-1.7037
81	Q	A	-2.1192
82	F	A	-0.7303
83	L	A	-0.4060
84	Q	A	-1.4983
85	S	A	-1.4263
86	G	A	-1.6779
87	K	A	-2.5405
88	K	A	-2.3321
89	V	A	-0.5419
90	P	A	-0.4576
91	N	A	-0.2380
92	I	A	1.5787
93	V	A	0.8622
94	R	A	-1.9968
95	N	A	-2.9553
96	D	A	-3.8920
97	E	A	-4.0071
98	H	A	-3.0992
99	P	A	-2.0968
100	Q	A	-1.7227
101	H	A	-0.7452
102	Y	A	0.9438
103	F	A	1.1067
104	Q	A	-1.0072
105	E	A	-2.1169
106	G	A	-1.6687
107	P	A	-1.2337
108	G	A	-1.1302
109	P	A	-0.8086
110	G	A	-0.8443
111	T	A	-0.3378
112	P	A	-0.1414
113	S	A	0.2126
114	I	A	1.5437
115	Q	A	0.5380
116	A	A	1.4818
117	I	A	2.9805
118	V	A	3.1139
119	P	A	2.6088
120	L	A	3.4002
121	L	A	3.0305
122	V	A	2.1223
123	P	A	-0.2277
124	E	A	-2.2858
125	E	A	-2.8560
126	G	A	-2.0445
127	P	A	-1.1565
128	G	A	-1.0676
129	P	A	-0.9951
130	G	A	-1.2291
131	H	A	-1.4818
132	T	A	-0.6165
133	P	A	-0.3039
134	S	A	0.1263
135	I	A	1.5341
136	Q	A	0.5332
137	A	A	1.5210
138	I	A	2.9754
139	V	A	3.1339
140	P	A	2.6233
141	L	A	3.3966
142	L	A	3.0729
143	V	A	2.3443
144	P	A	0.5314
145	E	A	-1.1183
146	A	A	-0.5089
147	A	A	0.2071
148	Y	A	0.5381
149	R	A	-0.4092
150	V	A	0.7490
151	K	A	-0.2930
152	V	A	0.8437
153	K	A	-0.8009
154	S	A	-0.1728
155	M	A	0.5493
156	S	A	-0.2582
157	K	A	-1.6072
158	G	A	-1.3421
159	P	A	-1.2393
160	G	A	-0.9298
161	P	A	-0.4366
162	G	A	0.5837
163	F	A	2.5964
164	L	A	3.1407
165	I	A	3.3083
166	S	A	1.6747
167	G	A	1.4750
168	I	A	2.6050
169	L	A	2.6535
170	S	A	1.5373
171	L	A	1.8461