Project name: Design14_0_1

Status: done

Started: 2026-07-22 17:27:49
Settings
Chain sequence(s) D: EQPLVLTLLTDASGRKWIVATAREENAPALEALAKKRGPPEHSYSGNRDA
F: QGAIEVGRTLLWPATPEDAELLAQPPTPLAVNGSVNVNIGT
input PDB
Selected Chain(s) D,F
Distance of aggregation 5 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with all chain(s) selected           (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:46)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:47)
Show buried residues

Minimal score value
-2.4076
Maximal score value
1.7028
Average score
-0.3121
Total score value
-28.4053

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 E D -1.9916
2 Q D -1.2727
3 P D -0.4111
4 L D 0.3930
5 V D 1.6610
6 L D 1.0614
7 T D 0.2084
8 L D 0.5764
9 L D 1.1055
10 T D -0.1815
11 D D -0.7072
12 A D -0.1036
13 S D -0.2509
14 G D -0.4636
15 R D -1.1033
16 K D -1.3117
17 W D 0.0421
18 I D 0.0000
19 V D 0.2148
20 A D 0.0000
21 T D 0.1408
22 A D 0.0000
23 R D -1.7982
24 E D -2.4076
25 E D -2.1873
26 N D -0.5781
27 A D -0.0818
28 P D -0.4029
29 A D -0.0297
30 L D 0.0000
31 E D -1.5143
32 A D -0.1990
33 L D 0.2898
34 A D -0.4001
35 K D -2.0049
36 K D -2.1380
37 R D -1.0645
38 G D -0.3216
39 P D -0.2916
40 P D -0.3211
41 E D -1.2489
42 H D -0.9284
43 S D -0.0921
44 Y D 1.2365
45 S D -0.0568
46 G D -0.7171
47 N D -1.6435
48 R D -2.3447
49 D D -2.0868
50 A D -0.2495
1 Q F -1.2772
2 G F -0.6588
3 A F 0.2638
4 I F 1.3121
5 E F -1.3670
6 V F 0.6930
7 G F -0.4324
8 R F -0.6957
9 T F -0.1307
10 L F 0.0000
11 L F 0.2080
12 W F 0.0000
13 P F -0.0526
14 A F 0.0078
15 T F -0.0684
16 P F -0.5775
17 E F -1.8949
18 D F -0.4813
19 A F -0.3393
20 E F -1.5442
21 L F 1.2926
22 L F 0.6573
23 A F -0.0859
24 Q F -1.2333
25 P F -0.5118
26 P F -0.3131
27 T F -0.1615
28 P F 0.0332
29 L F 1.5077
30 A F 0.6299
31 V F 1.5515
32 N F -1.0337
33 G F -0.7301
34 S F 0.0085
35 V F 1.5260
36 N F -0.6832
37 V F 1.3623
38 N F -0.6383
39 I F 1.7028
40 G F -0.1228
41 T F -0.1521
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018