Project name: query_structure

Status: done

Started: 2026-03-16 23:06:00
Settings
Chain sequence(s) A: ECLGFGKGCNPSNDQCCKSSNLVCSRKHAWCKYEI
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:21)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:21)
Show buried residues

Minimal score value
-3.3564
Maximal score value
1.2177
Average score
-1.4055
Total score value
-49.1942

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 E A -1.6515
2 C A -0.9070
3 L A -0.3601
4 G A -0.1656
5 F A 1.0782
6 G A -0.3393
7 K A -1.5724
8 G A -1.5931
9 C A -2.1977
10 N A -2.8709
11 P A -2.4825
12 S A -1.9038
13 N A -2.5433
14 D A -2.4801
15 Q A -2.5586
16 C A 0.0000
17 C A -1.1074
18 K A -2.2461
19 S A -1.4090
20 S A -1.0937
21 N A -1.7319
22 L A 0.0000
23 V A -0.9321
24 C A -1.8807
25 S A -2.3395
26 R A -3.3564
27 K A -3.1473
28 H A -2.6394
29 A A -2.5142
30 W A -1.6401
31 C A 0.0000
32 K A -1.4149
33 Y A 0.1541
34 E A -0.5656
35 I A 1.2177
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018