| Chain sequence(s) |
A: RYNYSSECEQLVNEQINHELNASYFYTALGTYYSQPTVALPGVANYFLAQSNEERRHAHALIQYQNGRGGKVQFSAIQAPPDFSKVLTGGEAATVTTRGFELAIETERMVYDKIRYIYQVAESQRDFALTGFLQKLIDEQVESLRELQELYTKSKRMVNEYWFDQ
input PDB |
| Selected Chain(s) | A |
| Distance of aggregation | 5 Å |
| FoldX usage | Yes |
| Dynamic mode | No |
| Automated mutations | Yes |
| Downloads | Download all the data |
| Simulation log |
[INFO] Logger: Verbosity set to: 2 - [INFO] (00:00:01)
[WARNING] runJob: Working directory already exists (possibly overwriting previous results -ow
to prevent this behavior) (00:00:01)
[INFO] runJob: Starting aggrescan3d job on: input.pdb with A chain(s) selected (00:00:01)
[INFO] runJob: Creating pdb object from: input.pdb (00:00:01)
[INFO] FoldX: Starting FoldX energy minimalization (00:00:01)
[INFO] Analysis: Starting Aggrescan3D on folded.pdb (00:04:36)
[INFO] Auto_mut: Residue number 127 from chain A and a score of 1.951 (phenylalanine)
selected for automated muatation (00:04:37)
[INFO] Auto_mut: Residue number 74 from chain A and a score of 1.682 (phenylalanine)
selected for automated muatation (00:04:37)
[INFO] Auto_mut: Residue number 158 from chain A and a score of 1.650 (valine) selected for
automated muatation (00:04:37)
[INFO] Auto_mut: Residue number 162 from chain A and a score of 1.395 (tryptophan) selected
for automated muatation (00:04:37)
[INFO] Auto_mut: Residue number 141 from chain A and a score of 1.292 (valine) selected for
automated muatation (00:04:37)
[INFO] Auto_mut: Residue number 161 from chain A and a score of 1.119 (tyrosine) selected
for automated muatation (00:04:37)
[INFO] Auto_mut: Mutating residue number 127 from chain A (phenylalanine) into glutamic acid
Mutating residue number 127 from chain A (phenylalanine) into glutamic acid (00:04:37)
[INFO] Auto_mut: Mutating residue number 74 from chain A (phenylalanine) into glutamic acid
Mutating residue number 74 from chain A (phenylalanine) into glutamic acid (00:04:37)
[INFO] Auto_mut: Mutating residue number 127 from chain A (phenylalanine) into aspartic acid
Mutating residue number 127 from chain A (phenylalanine) into aspartic acid (00:04:37)
[INFO] Auto_mut: Mutating residue number 74 from chain A (phenylalanine) into lysine (00:06:32)
[INFO] Auto_mut: Mutating residue number 127 from chain A (phenylalanine) into arginine (00:06:34)
[INFO] Auto_mut: Mutating residue number 127 from chain A (phenylalanine) into lysine (00:06:40)
[INFO] Auto_mut: Mutating residue number 74 from chain A (phenylalanine) into aspartic acid
Mutating residue number 74 from chain A (phenylalanine) into aspartic acid (00:08:30)
[INFO] Auto_mut: Mutating residue number 158 from chain A (valine) into glutamic acid (00:08:43)
[INFO] Auto_mut: Mutating residue number 158 from chain A (valine) into aspartic acid (00:08:53)
[INFO] Auto_mut: Mutating residue number 74 from chain A (phenylalanine) into arginine (00:10:32)
[INFO] Auto_mut: Mutating residue number 158 from chain A (valine) into lysine (00:10:41)
[INFO] Auto_mut: Mutating residue number 158 from chain A (valine) into arginine (00:10:48)
[INFO] Auto_mut: Mutating residue number 162 from chain A (tryptophan) into glutamic acid (00:12:41)
[INFO] Auto_mut: Mutating residue number 162 from chain A (tryptophan) into aspartic acid (00:12:47)
[INFO] Auto_mut: Mutating residue number 141 from chain A (valine) into glutamic acid (00:12:48)
[INFO] Auto_mut: Mutating residue number 162 from chain A (tryptophan) into arginine (00:14:34)
[INFO] Auto_mut: Mutating residue number 162 from chain A (tryptophan) into lysine (00:14:36)
[INFO] Auto_mut: Mutating residue number 141 from chain A (valine) into lysine (00:14:40)
[INFO] Auto_mut: Mutating residue number 141 from chain A (valine) into aspartic acid (00:16:39)
[INFO] Auto_mut: Mutating residue number 161 from chain A (tyrosine) into glutamic acid (00:17:12)
[INFO] Auto_mut: Mutating residue number 161 from chain A (tyrosine) into aspartic acid (00:17:14)
[INFO] Auto_mut: Mutating residue number 141 from chain A (valine) into arginine (00:18:32)
[INFO] Auto_mut: Mutating residue number 161 from chain A (tyrosine) into lysine (00:19:04)
[INFO] Auto_mut: Mutating residue number 161 from chain A (tyrosine) into arginine (00:19:12)
[INFO] Auto_mut: Effect of mutation residue number 127 from chain A (phenylalanine) into
glutamic acid: Energy difference: -0.0111 kcal/mol, Difference in average
score from the base case: -0.0275 (00:21:50)
[INFO] Auto_mut: Effect of mutation residue number 127 from chain A (phenylalanine) into
lysine: Energy difference: -0.0230 kcal/mol, Difference in average score
from the base case: -0.0255 (00:21:50)
[INFO] Auto_mut: Effect of mutation residue number 127 from chain A (phenylalanine) into
aspartic acid: Energy difference: -0.5468 kcal/mol, Difference in average
score from the base case: -0.0270 (00:21:50)
[INFO] Auto_mut: Effect of mutation residue number 127 from chain A (phenylalanine) into
arginine: Energy difference: -0.4299 kcal/mol, Difference in average score
from the base case: -0.0289 (00:21:50)
[INFO] Auto_mut: Effect of mutation residue number 74 from chain A (phenylalanine) into
glutamic acid: Energy difference: 1.7016 kcal/mol, Difference in average
score from the base case: -0.0311 (00:21:50)
[INFO] Auto_mut: Effect of mutation residue number 74 from chain A (phenylalanine) into
lysine: Energy difference: 1.0867 kcal/mol, Difference in average score
from the base case: -0.0295 (00:21:50)
[INFO] Auto_mut: Effect of mutation residue number 74 from chain A (phenylalanine) into
aspartic acid: Energy difference: 2.3641 kcal/mol, Difference in average
score from the base case: -0.0278 (00:21:50)
[INFO] Auto_mut: Effect of mutation residue number 74 from chain A (phenylalanine) into
arginine: Energy difference: 0.9179 kcal/mol, Difference in average score
from the base case: -0.0322 (00:21:50)
[INFO] Auto_mut: Effect of mutation residue number 158 from chain A (valine) into glutamic
acid: Energy difference: -0.2261 kcal/mol, Difference in average score from
the base case: -0.0296 (00:21:50)
[INFO] Auto_mut: Effect of mutation residue number 158 from chain A (valine) into lysine:
Energy difference: -0.2642 kcal/mol, Difference in average score from the
base case: -0.0263 (00:21:50)
[INFO] Auto_mut: Effect of mutation residue number 158 from chain A (valine) into aspartic
acid: Energy difference: -0.5492 kcal/mol, Difference in average score from
the base case: -0.0299 (00:21:50)
[INFO] Auto_mut: Effect of mutation residue number 158 from chain A (valine) into arginine:
Energy difference: -0.2667 kcal/mol, Difference in average score from the
base case: -0.0296 (00:21:50)
[INFO] Auto_mut: Effect of mutation residue number 162 from chain A (tryptophan) into
glutamic acid: Energy difference: 0.6388 kcal/mol, Difference in average
score from the base case: -0.0230 (00:21:50)
[INFO] Auto_mut: Effect of mutation residue number 162 from chain A (tryptophan) into
lysine: Energy difference: 0.5713 kcal/mol, Difference in average score
from the base case: -0.0173 (00:21:50)
[INFO] Auto_mut: Effect of mutation residue number 162 from chain A (tryptophan) into
aspartic acid: Energy difference: 1.1022 kcal/mol, Difference in average
score from the base case: -0.0240 (00:21:50)
[INFO] Auto_mut: Effect of mutation residue number 162 from chain A (tryptophan) into
arginine: Energy difference: 0.4957 kcal/mol, Difference in average score
from the base case: -0.0232 (00:21:50)
[INFO] Auto_mut: Effect of mutation residue number 141 from chain A (valine) into glutamic
acid: Energy difference: 0.1558 kcal/mol, Difference in average score from
the base case: -0.0240 (00:21:50)
[INFO] Auto_mut: Effect of mutation residue number 141 from chain A (valine) into lysine:
Energy difference: -0.6228 kcal/mol, Difference in average score from the
base case: -0.0231 (00:21:50)
[INFO] Auto_mut: Effect of mutation residue number 141 from chain A (valine) into aspartic
acid: Energy difference: -1.0080 kcal/mol, Difference in average score from
the base case: -0.0256 (00:21:50)
[INFO] Auto_mut: Effect of mutation residue number 141 from chain A (valine) into arginine:
Energy difference: -0.3655 kcal/mol, Difference in average score from the
base case: -0.0268 (00:21:50)
[INFO] Auto_mut: Effect of mutation residue number 161 from chain A (tyrosine) into glutamic
acid: Energy difference: 0.3409 kcal/mol, Difference in average score from
the base case: -0.0186 (00:21:50)
[INFO] Auto_mut: Effect of mutation residue number 161 from chain A (tyrosine) into lysine:
Energy difference: -0.2990 kcal/mol, Difference in average score from the
base case: -0.0126 (00:21:50)
[INFO] Auto_mut: Effect of mutation residue number 161 from chain A (tyrosine) into aspartic
acid: Energy difference: 1.6077 kcal/mol, Difference in average score from
the base case: -0.0144 (00:21:50)
[INFO] Auto_mut: Effect of mutation residue number 161 from chain A (tyrosine) into
arginine: Energy difference: -0.8218 kcal/mol, Difference in average score
from the base case: -0.0122 (00:21:50)
[INFO] Main: Simulation completed successfully. (00:21:57)
|
The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.
| residue index | residue name | chain | Aggrescan3D score | mutation |
|---|---|---|---|---|
| residue index | residue name | chain | Aggrescan3D score | |
| 1 | R | A | -1.6581 | |
| 2 | Y | A | 0.7523 | |
| 3 | N | A | -1.0376 | |
| 4 | Y | A | 0.0000 | |
| 5 | S | A | -0.1196 | |
| 6 | S | A | -0.5443 | |
| 7 | E | A | -1.6699 | |
| 8 | C | A | 0.0000 | |
| 9 | E | A | -0.4360 | |
| 10 | Q | A | -1.2340 | |
| 11 | L | A | 0.0000 | |
| 12 | V | A | 0.0000 | |
| 13 | N | A | 0.0000 | |
| 14 | E | A | -0.9944 | |
| 15 | Q | A | 0.0000 | |
| 16 | I | A | 0.0000 | |
| 17 | N | A | 0.0000 | |
| 18 | H | A | -0.2515 | |
| 19 | E | A | 0.0000 | |
| 20 | L | A | 0.1847 | |
| 21 | N | A | -0.1537 | |
| 22 | A | A | 0.0000 | |
| 23 | S | A | 0.0000 | |
| 24 | Y | A | 0.8307 | |
| 25 | F | A | 0.3495 | |
| 26 | Y | A | 0.0000 | |
| 27 | T | A | -0.0213 | |
| 28 | A | A | -0.0013 | |
| 29 | L | A | 0.0000 | |
| 30 | G | A | 0.0000 | |
| 31 | T | A | -0.0372 | |
| 32 | Y | A | 0.1257 | |
| 33 | Y | A | 0.0000 | |
| 34 | S | A | -0.2665 | |
| 35 | Q | A | -0.6240 | |
| 36 | P | A | -0.3653 | |
| 37 | T | A | -0.0583 | |
| 38 | V | A | 0.3274 | |
| 39 | A | A | 0.1172 | |
| 40 | L | A | 0.0000 | |
| 41 | P | A | -0.2999 | |
| 42 | G | A | -0.3224 | |
| 43 | V | A | 0.0000 | |
| 44 | A | A | 0.0000 | |
| 45 | N | A | -1.2365 | |
| 46 | Y | A | -0.0308 | |
| 47 | F | A | 0.0000 | |
| 48 | L | A | 0.6177 | |
| 49 | A | A | 0.1574 | |
| 50 | Q | A | 0.0000 | |
| 51 | S | A | 0.0000 | |
| 52 | N | A | -1.4697 | |
| 53 | E | A | -1.4953 | |
| 54 | E | A | 0.0000 | |
| 55 | R | A | -1.2521 | |
| 56 | R | A | -2.0201 | |
| 57 | H | A | 0.0000 | |
| 58 | A | A | 0.0000 | |
| 59 | H | A | -0.9446 | |
| 60 | A | A | -0.1578 | |
| 61 | L | A | 0.0000 | |
| 62 | I | A | 0.0928 | |
| 63 | Q | A | -1.0948 | |
| 64 | Y | A | -0.1053 | |
| 65 | Q | A | 0.0000 | |
| 66 | N | A | -1.3566 | |
| 67 | G | A | -0.7207 | |
| 68 | R | A | -0.4050 | |
| 69 | G | A | -0.7285 | |
| 70 | G | A | -0.4531 | |
| 71 | K | A | -1.6694 | |
| 72 | V | A | -0.3042 | |
| 73 | Q | A | -0.8000 | |
| 74 | F | A | 1.6819 | |
| 75 | S | A | 0.1519 | |
| 76 | A | A | 0.1645 | |
| 77 | I | A | 0.5914 | |
| 78 | Q | A | -1.0409 | |
| 79 | A | A | -0.1723 | |
| 80 | P | A | -0.0679 | |
| 81 | P | A | -0.4905 | |
| 82 | D | A | -1.8175 | |
| 83 | F | A | 0.0000 | |
| 84 | S | A | -0.5185 | |
| 85 | K | A | -1.6832 | |
| 86 | V | A | -0.0057 | |
| 87 | L | A | 0.0000 | |
| 88 | T | A | -0.1520 | |
| 89 | G | A | -0.5487 | |
| 90 | G | A | -0.8770 | |
| 91 | E | A | -1.9022 | |
| 92 | A | A | -0.3046 | |
| 93 | A | A | 0.0589 | |
| 94 | T | A | 0.0552 | |
| 95 | V | A | 0.2983 | |
| 96 | T | A | 0.0000 | |
| 97 | T | A | 0.0000 | |
| 98 | R | A | -0.3057 | |
| 99 | G | A | 0.0000 | |
| 100 | F | A | 0.0000 | |
| 101 | E | A | -0.3734 | |
| 102 | L | A | 0.0279 | |
| 103 | A | A | 0.0000 | |
| 104 | I | A | -0.0620 | |
| 105 | E | A | -1.7458 | |
| 106 | T | A | -0.3356 | |
| 107 | E | A | 0.0000 | |
| 108 | R | A | -1.5327 | |
| 109 | M | A | 0.1770 | |
| 110 | V | A | 0.0000 | |
| 111 | Y | A | 0.0536 | |
| 112 | D | A | -1.1378 | |
| 113 | K | A | -0.9122 | |
| 114 | I | A | 0.0000 | |
| 115 | R | A | -1.6575 | |
| 116 | Y | A | 0.6883 | |
| 117 | I | A | 0.0000 | |
| 118 | Y | A | 0.0212 | |
| 119 | Q | A | -1.1226 | |
| 120 | V | A | -0.0309 | |
| 121 | A | A | 0.0000 | |
| 122 | E | A | -1.3111 | |
| 123 | S | A | -0.5806 | |
| 124 | Q | A | -1.5556 | |
| 125 | R | A | -2.1708 | |
| 126 | D | A | 0.0000 | |
| 127 | F | A | 1.9512 | |
| 128 | A | A | 0.4081 | |
| 129 | L | A | 0.0000 | |
| 130 | T | A | 0.0000 | |
| 131 | G | A | -0.1324 | |
| 132 | F | A | 0.3022 | |
| 133 | L | A | 0.0000 | |
| 134 | Q | A | -0.8380 | |
| 135 | K | A | -1.7999 | |
| 136 | L | A | 0.0000 | |
| 137 | I | A | -0.1437 | |
| 138 | D | A | -1.8551 | |
| 139 | E | A | -0.9269 | |
| 140 | Q | A | 0.0000 | |
| 141 | V | A | 1.2919 | |
| 142 | E | A | -1.1418 | |
| 143 | S | A | -0.2791 | |
| 144 | L | A | 0.0000 | |
| 145 | R | A | -1.9589 | |
| 146 | E | A | -1.0698 | |
| 147 | L | A | 0.0000 | |
| 148 | Q | A | -1.1500 | |
| 149 | E | A | -1.9195 | |
| 150 | L | A | -0.0275 | |
| 151 | Y | A | 0.2218 | |
| 152 | T | A | -0.2383 | |
| 153 | K | A | -1.3300 | |
| 154 | S | A | 0.0000 | |
| 155 | K | A | -1.8801 | |
| 156 | R | A | -2.0767 | |
| 157 | M | A | 0.2449 | |
| 158 | V | A | 1.6502 | |
| 159 | N | A | -0.6783 | |
| 160 | E | A | -0.3061 | |
| 161 | Y | A | 1.1193 | |
| 162 | W | A | 1.3946 | |
| 163 | F | A | 0.3655 | |
| 164 | D | A | -0.4407 | |
| 165 | Q | A | -1.2402 |
Automated mutations analysis
In the automated mutations mode, the server selects aggregation prone resides
and each selected residue is mutated to glutamic acid, lysine, aspartic acid and arginine.
The table below shows 2 best scored mutants for each mutated residue. Protein variants
are ordered according to the mutation effect they had on protein stability
(energetic effect) together with the difference in the average per-residue aggregation score
between the wild type and the mutant (in the table green values indicate a positive change,
grey are neutral, and orange/red mean destabilizing or more aggregation prone mutants).
Summary for all the mutants can be found in this
CSV file.
Mutant |
Energetic effect |
Score comparison |
|||
| VD141A | -1.008 | -0.0256 | View | CSV | PDB |
| VD158A | -0.5492 | -0.0299 | View | CSV | PDB |
| FD127A | -0.5468 | -0.027 | View | CSV | PDB |
| FR127A | -0.4299 | -0.0289 | View | CSV | PDB |
| VK141A | -0.6228 | -0.0231 | View | CSV | PDB |
| VR158A | -0.2667 | -0.0296 | View | CSV | PDB |
| YR161A | -0.8218 | -0.0122 | View | CSV | PDB |
| YK161A | -0.299 | -0.0126 | View | CSV | PDB |
| WR162A | 0.4957 | -0.0232 | View | CSV | PDB |
| WE162A | 0.6388 | -0.023 | View | CSV | PDB |
| FR74A | 0.9179 | -0.0322 | View | CSV | PDB |
| FK74A | 1.0867 | -0.0295 | View | CSV | PDB |