Project name: ba4d3303a8747a2

Chain sequence(s)	A: MDREMILADFQACTGIENIDEAITLLEQNNWDLVAAINGV
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:13)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:14)

• Minimal score value: -2.9266
• Maximal score value: 1.004
• Average score: -0.9413
• Total score value: -36.7104

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	M	A	-0.1813
2	D	A	-1.6823
3	R	A	-2.0336
4	E	A	-2.5151
5	M	A	-0.9995
6	I	A	-0.9854
7	L	A	-0.7538
8	A	A	-0.9635
9	D	A	-1.5917
10	F	A	0.0000
11	Q	A	-0.6869
12	A	A	-0.5736
13	C	A	0.1317
14	T	A	-0.2516
15	G	A	-0.8060
16	I	A	-0.8446
17	E	A	-1.9983
18	N	A	-1.2341
19	I	A	0.2240
20	D	A	-1.6665
21	E	A	-2.0285
22	A	A	0.0000
23	I	A	-0.6273
24	T	A	-1.3741
25	L	A	-1.0138
26	L	A	0.0000
27	E	A	-2.9266
28	Q	A	-2.5840
29	N	A	-2.2575
30	N	A	-2.3425
31	W	A	-0.9272
32	D	A	-1.5205
33	L	A	-0.4277
34	V	A	1.0040
35	A	A	0.3207
36	A	A	0.0203
37	I	A	0.4525
38	N	A	-0.7010
39	G	A	-0.3651