Project name: ba50a20a062780d

Chain sequence(s)	A: RFHLLHWHGNYLQHGCRNWGHYISVPIQPQDERYLSKTGRTDIANLAEEFKDHLVPD
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:34)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:35)

• Minimal score value: -3.1158
• Maximal score value: 2.9554
• Average score: -0.7111
• Total score value: -40.5353

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	R	A	-0.5652
2	F	A	1.4244
3	H	A	0.5190
4	L	A	1.8618
5	L	A	1.7818
6	H	A	0.6144
7	W	A	1.5901
8	H	A	0.7663
9	G	A	-0.0049
10	N	A	-0.4272
11	Y	A	0.7287
12	L	A	0.3803
13	Q	A	-1.4417
14	H	A	-1.6147
15	G	A	-0.7487
16	C	A	-0.6567
17	R	A	-2.3146
18	N	A	-1.2942
19	W	A	0.4978
20	G	A	0.1942
21	H	A	0.0961
22	Y	A	1.9761
23	I	A	2.9554
24	S	A	2.0344
25	V	A	2.4558
26	P	A	1.6245
27	I	A	0.5319
28	Q	A	-1.3468
29	P	A	-1.8994
30	Q	A	-2.4860
31	D	A	-2.4016
32	E	A	-3.0580
33	R	A	-3.0999
34	Y	A	-1.4291
35	L	A	-1.8659
36	S	A	-2.3389
37	K	A	-2.4410
38	T	A	-1.3945
39	G	A	-1.6097
40	R	A	-2.1342
41	T	A	-1.9323
42	D	A	-1.8127
43	I	A	-0.6484
44	A	A	-1.6673
45	N	A	-2.2921
46	L	A	-0.5422
47	A	A	-1.4113
48	E	A	-3.1158
49	E	A	-2.8327
50	F	A	-1.4417
51	K	A	-2.5702
52	D	A	-2.8797
53	H	A	-1.7492
54	L	A	0.4875
55	V	A	0.8196
56	P	A	-0.7186
57	D	A	-1.6883