Project name: Z003

Status: done

Started: 2026-05-16 18:53:32
Settings
Chain sequence(s) A: AAQLTQSPSSLSASVGDRVTITCRASQDISSALVWYQQKPGKAPKLLIYDASSLESGVPSRFSGSESGTDTTLTISSLQPEDFATYYCQQFNSYPLTFGGGTKVEIKGGGGSGGGGSGGGGSQVTLQEKDGGVCQPGRSLRLSCAQSGFTFSTYGMEWVPQAPGKGLEWVAVIWDDGSYKYKGDSVKGRFTISRDNSKNTLYLQMNSLRATDTAYYYCARDGITMVRGVMKDYFDYWGQGTLVTVSS
input PDB
Selected Chain(s) A
Distance of aggregation 5 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:03:23)
[INFO]       Main:     Simulation completed successfully.                                          (00:03:25)
Show buried residues

Minimal score value
-2.0076
Maximal score value
1.7578
Average score
-0.2664
Total score value
-65.7926

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 A A 0.0585
2 A A 0.0000
3 Q A -1.1983
4 L A 0.0000
5 T A -0.0709
6 Q A 0.0000
7 S A -0.2395
8 P A -0.1921
9 S A -0.2636
10 S A -0.3293
11 L A 0.1947
12 S A -0.5291
13 A A 0.0000
14 S A 0.1612
15 V A 1.1755
16 G A -0.3518
17 D A -1.2131
18 R A -2.0001
19 V A 0.0000
20 T A -0.0643
21 I A 0.0000
22 T A -0.0196
23 C A 0.0000
24 R A -1.8908
25 A A 0.0000
26 S A -0.4126
27 Q A -1.3464
28 D A -1.6716
29 I A 0.0000
30 S A -0.0363
31 S A -0.1065
32 A A 0.0000
33 L A 0.0000
34 V A 0.0000
35 W A 0.0000
36 Y A 0.0000
37 Q A 0.0000
38 Q A 0.0000
39 K A -0.4918
40 P A -0.4269
41 G A -0.8356
42 K A -1.7862
43 A A -0.3032
44 P A 0.0000
45 K A -1.1991
46 L A 0.0000
47 L A 0.0000
48 I A 0.0000
49 Y A 0.2294
50 D A -0.2551
51 A A 0.0000
52 S A -0.2119
53 S A 0.0023
54 L A 0.4687
55 E A -0.4321
56 S A -0.3925
57 G A -0.4674
58 V A 0.0934
59 P A -0.1379
60 S A -0.2980
61 R A -0.3647
62 F A 0.0000
63 S A -0.1414
64 G A -0.1518
65 S A -0.3684
66 E A -0.8547
67 S A -0.4452
68 G A -0.5094
69 T A -0.1791
70 D A -0.6030
71 T A 0.0000
72 T A -0.0167
73 L A 0.0000
74 T A -0.0241
75 I A 0.0000
76 S A -0.3066
77 S A -0.1355
78 L A 0.0000
79 Q A -0.4254
80 P A -0.6586
81 E A -1.8668
82 D A 0.0000
83 F A 0.2780
84 A A 0.0000
85 T A -0.1697
86 Y A 0.0000
87 Y A 0.0000
88 C A 0.0000
89 Q A 0.0000
90 Q A 0.0000
91 F A 0.0000
92 N A -0.3130
93 S A -0.2040
94 Y A 0.2199
95 P A 0.0114
96 L A 0.0000
97 T A 0.0303
98 F A 0.2020
99 G A 0.0000
100 G A -0.4663
101 G A 0.0000
102 T A 0.0000
103 K A -1.1821
104 V A 0.0000
105 E A -1.3959
106 I A 0.5083
107 K A -1.6115
108 G A -0.8547
109 G A -0.6297
110 G A -0.6406
111 G A -0.5940
112 S A -0.3784
113 G A -0.5869
114 G A -0.6358
115 G A -0.6406
116 G A -0.5926
117 S A -0.3808
118 G A -0.6027
119 G A -0.6512
120 G A -0.6400
121 G A -0.5921
122 S A -0.5210
123 Q A -1.1893
124 V A -0.0171
125 T A 0.0101
126 L A 0.0000
127 Q A -0.7382
128 E A 0.0000
129 K A -1.3178
130 D A -2.0033
131 G A -0.5314
132 G A 0.1479
133 V A 1.7578
134 C A 0.3001
135 Q A -0.5767
136 P A -0.2640
137 G A -0.8450
138 R A -1.9590
139 S A -0.5331
140 L A -0.0843
141 R A -1.6415
142 L A 0.0000
143 S A 0.0000
144 C A 0.0000
145 A A 0.0168
146 Q A 0.0000
147 S A -0.2957
148 G A -0.4140
149 F A 0.1722
150 T A -0.0221
151 F A 0.0000
152 S A -0.1282
153 T A -0.0291
154 Y A 0.2441
155 G A 0.0000
156 M A 0.0000
157 E A 0.0000
158 W A 0.0000
159 V A 0.0000
160 P A -0.0470
161 Q A -0.0561
162 A A -0.0526
163 P A -0.3068
164 G A -0.8413
165 K A -1.8156
166 G A -0.4442
167 L A 0.0000
168 E A -1.6313
169 W A 0.0000
170 V A 0.0000
171 A A 0.0000
172 V A 0.0000
173 I A 0.0000
174 W A 0.5503
175 D A -0.7564
176 D A -1.9249
177 G A -0.5230
178 S A -0.1244
179 Y A 0.3714
180 K A -0.7767
181 Y A 0.3371
182 K A -0.2957
183 G A -0.4525
184 D A -2.0076
185 S A -0.5459
186 V A 0.0000
187 K A -1.9667
188 G A -0.8406
189 R A -0.4525
190 F A 0.0000
191 T A -0.0690
192 I A 0.0000
193 S A -0.1308
194 R A -0.3675
195 D A -0.9713
196 N A -0.9417
197 S A -0.6585
198 K A -1.8296
199 N A -0.8769
200 T A 0.0000
201 L A 0.0000
202 Y A 0.1490
203 L A 0.0000
204 Q A -0.5544
205 M A 0.0000
206 N A -0.6401
207 S A -0.3338
208 L A 0.0000
209 R A -1.2693
210 A A -0.2005
211 T A -0.0603
212 D A 0.0000
213 T A -0.0167
214 A A 0.0000
215 Y A 0.7338
216 Y A 0.0000
217 Y A 0.0000
218 C A 0.0000
219 A A 0.0000
220 R A 0.0000
221 D A -0.2169
222 G A 0.0000
223 I A 1.5575
224 T A 0.4735
225 M A 1.1256
226 V A 0.0000
227 R A -1.9304
228 G A -0.5005
229 V A 1.7342
230 M A 1.4093
231 K A -0.1774
232 D A -0.2573
233 Y A 0.0000
234 F A 0.0000
235 D A -0.1415
236 Y A 0.5389
237 W A 0.2259
238 G A 0.0000
239 Q A -1.1983
240 G A 0.0000
241 T A 0.1717
242 L A 1.0376
243 V A 0.0000
244 T A 0.2067
245 V A 0.0000
246 S A -0.1604
247 S A -0.2344
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018