Project name: 2569916ea8a2b280afb6eb8e95b02e90

Status: done

Started: 2026-03-07 01:29:35
Settings
Chain sequence(s) B: AADPSLTGADYERVKKSAEYFKERLALVRANKAAGAPPVGAPPVDGVDQPGGNDAAIAAYEALVERLQAGVDYISETYGVGSGC
input PDB
Selected Chain(s) B
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with B chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:58)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:59)
Show buried residues

Minimal score value
-3.8654
Maximal score value
0.8724
Average score
-1.2143
Total score value
-102.0006

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 A B -0.9826
2 A B -1.6296
3 D B -1.7084
4 P B -0.8974
5 S B -0.7196
6 L B -0.4599
7 T B -0.1642
8 G B -0.2148
9 A B -0.7515
10 D B -1.6806
11 Y B 0.0000
12 E B -3.4995
13 R B -3.8654
14 V B 0.0000
15 K B -3.5060
16 K B -3.7157
17 S B -2.4962
18 A B 0.0000
19 E B -3.2853
20 Y B -1.6866
21 F B -1.5478
22 K B -2.7551
23 E B -2.5897
24 R B -1.4795
25 L B -1.4343
26 A B -1.3454
27 L B -0.8443
28 V B 0.0000
29 R B -2.6990
30 A B -1.3039
31 N B -1.5632
32 K B -2.8209
33 A B -1.3560
34 A B -1.0262
35 G B -1.3433
36 A B -0.8533
37 P B -0.8549
38 P B -1.3565
39 V B -0.6153
40 G B -0.6754
41 A B -0.7108
42 P B -0.6525
43 P B -0.9894
44 V B -0.7644
45 D B -1.6798
46 G B -0.9205
47 V B 0.0402
48 D B -1.5274
49 Q B -1.1090
50 P B -1.0665
51 G B -1.2923
52 G B -1.4013
53 N B -2.1427
54 D B -2.4788
55 A B -1.2102
56 A B 0.0000
57 I B -1.4098
58 A B -0.7795
59 A B -0.5884
60 Y B 0.0000
61 E B -2.1138
62 A B -1.7178
63 L B 0.0000
64 V B 0.0000
65 E B -3.2462
66 R B -3.3296
67 L B -2.6220
68 Q B -2.3754
69 A B -2.0052
70 G B 0.0000
71 V B 0.0000
72 D B -2.2591
73 Y B -1.3552
74 I B 0.0000
75 S B -0.6959
76 E B -1.7820
77 T B -0.5179
78 Y B 0.6427
79 G B 0.3625
80 V B 0.6729
81 G B 0.0790
82 S B -0.1106
83 G B -0.0890
84 C B 0.8724
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018