Project name: sars2

Status: done

Started: 2025-07-17 06:20:22
Settings
Chain sequence(s) E: TNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCG
input PDB
Selected Chain(s) E
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with E chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:35)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:36)
Show buried residues

Minimal score value
-2.9938
Maximal score value
1.8356
Average score
-0.4307
Total score value
-83.5636

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
333 T E -0.4422
334 N E -0.6545
335 L E 0.6182
336 C E 0.0000
337 P E -0.5251
338 F E 0.0000
339 G E -1.6267
340 E E -2.5521
341 V E 0.0000
342 F E 0.0000
343 N E -2.2973
344 A E -1.9005
345 T E -1.3072
346 R E -1.8973
347 F E 0.0000
348 A E -0.7189
349 S E -0.2581
350 V E 0.0000
351 Y E 0.4438
352 A E 0.1368
353 W E 0.0000
354 N E -1.3547
355 R E -1.6029
356 K E -2.0874
357 R E -2.2554
358 I E 0.0000
359 S E -1.1435
360 N E -1.2547
361 C E -0.3663
362 V E 0.0638
363 A E 0.0000
364 D E -0.5488
365 Y E 0.0000
366 S E 0.0539
367 V E 1.2236
368 L E 0.7331
369 Y E 0.4809
370 N E -0.2853
371 S E 0.0584
372 A E -0.0072
373 S E -0.1536
374 F E 0.2138
375 S E -0.2242
376 T E -0.4397
377 F E -0.2882
378 K E -1.4261
379 C E -0.6057
380 Y E -0.5138
381 G E -0.6290
382 V E -0.4582
383 S E -0.8644
384 P E 0.0000
385 T E -1.2462
386 K E -2.1925
387 L E 0.0000
388 N E -1.5412
389 D E -2.2235
390 L E -0.4197
391 C E 0.4493
392 F E 0.0000
393 T E 0.0000
394 N E -0.3035
395 V E 0.0000
396 Y E -1.0045
397 A E 0.0000
398 D E 0.0000
399 S E 0.0000
400 F E 0.0000
401 V E 0.0000
402 I E 0.0000
403 R E -0.1817
404 G E -0.1911
405 D E -0.7742
406 E E -1.2049
407 V E -1.1171
408 R E -2.2449
409 Q E -1.7456
410 I E 0.0000
411 A E -1.3032
412 P E -1.7949
413 G E -1.6889
414 Q E -1.8150
415 T E -1.2909
416 G E -1.1537
417 K E -1.1139
418 I E 0.0000
419 A E 0.0000
420 D E -1.5458
421 Y E -1.2668
422 N E 0.0000
423 Y E 0.0000
424 K E -1.6354
425 L E 0.0000
426 P E -2.0084
427 D E -2.9938
428 D E -2.7846
429 F E 0.0000
430 T E -0.8420
431 G E 0.0000
432 C E 0.0000
433 V E 0.0000
434 I E 0.0000
435 A E 0.0000
436 W E -0.0277
437 N E -0.3342
438 S E 0.0000
439 N E -0.5307
440 N E -1.0791
441 L E 0.2235
442 D E 0.0000
443 S E -0.6988
444 K E -1.0549
445 V E 0.4655
446 G E -0.0729
447 G E 0.0000
448 N E 0.0184
449 Y E 0.6166
450 N E -0.0878
451 Y E 0.0000
452 L E 0.4042
453 Y E 0.2331
454 R E 0.0000
455 L E 0.3593
456 F E -0.1377
457 R E -1.5560
458 K E -2.1762
459 S E -1.8891
460 N E -2.4254
461 L E 0.0000
462 K E -2.3424
463 P E -1.5766
464 F E -0.5888
465 E E -1.4371
466 R E -1.0361
467 D E 0.1545
468 I E 1.4139
469 S E 0.1731
470 T E -0.3359
471 E E -1.3786
472 I E -0.7275
473 Y E -0.5944
474 Q E -1.6508
475 A E -0.5355
476 G E -0.4861
477 S E -0.7068
478 T E -0.5263
479 P E -0.9105
480 C E 0.0000
481 N E -1.6549
482 G E -0.9414
483 V E 0.4550
484 E E -0.7086
485 G E -0.1014
486 F E 1.2989
487 N E -0.0116
488 C E 0.0000
489 Y E 0.5383
490 F E 0.4421
491 P E 0.0000
492 L E 0.0000
493 Q E 0.0762
494 S E 0.1245
495 Y E 0.0000
496 G E 0.0029
497 F E 0.0000
498 Q E -0.7856
499 P E -0.4911
500 T E -0.1085
501 N E 0.0648
502 G E 0.4806
503 V E 1.5176
504 G E 0.7697
505 Y E 1.1068
506 Q E 0.2571
507 P E 0.0000
508 Y E 0.1808
509 R E 0.0000
510 V E 0.0000
511 V E 0.0000
512 V E 0.0000
513 L E 0.0000
514 S E -0.2488
515 F E 0.0000
516 E E 0.6741
517 L E 1.8356
518 L E 1.5682
519 H E -0.0053
520 A E 0.1058
521 P E -0.1204
522 A E 0.2200
523 T E -0.4517
524 V E 0.0000
525 C E -0.2737
526 G E -0.6965
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018