Project name: bba794e32a36303

Status: done

Started: 2026-07-01 15:22:53
Settings
Chain sequence(s) B: GSQTTVSISVSGSLVTVTLTSQAPRSYRGQLVSIDASGKTEVLQTFTVQT
input PDB
Selected Chain(s) B
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with B chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:26)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:26)
Show buried residues

Minimal score value
-2.038
Maximal score value
2.9948
Average score
-0.0568
Total score value
-2.8421

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 G B -0.9253
2 S B -1.3171
3 Q B -1.5221
4 T B -0.4901
5 T B 0.4167
6 V B 2.2765
7 S B 1.8405
8 I B 2.9948
9 S B 2.0174
10 V B 2.6059
11 S B 0.9596
12 G B 0.3112
13 S B 0.7509
14 L B 2.0368
15 V B 2.4789
16 T B 1.8472
17 V B 2.2335
18 T B 1.4572
19 L B 1.5035
20 T B 0.1162
21 S B -0.8622
22 Q B -1.6883
23 A B -1.1503
24 P B -0.9774
25 R B -1.0601
26 S B -1.2143
27 Y B -1.0326
28 R B -2.0380
29 G B -1.4409
30 Q B -1.3470
31 L B 0.4453
32 V B 0.4310
33 S B 0.1950
34 I B 0.4895
35 D B -1.2426
36 A B -0.6476
37 S B -0.9874
38 G B -1.3904
39 K B -2.0157
40 T B -0.8127
41 E B -1.1603
42 V B 0.5902
43 L B 0.6006
44 Q B -0.6330
45 T B -0.6773
46 F B -0.6960
47 T B -0.9045
48 V B -0.7478
49 Q B -1.5060
50 T B -0.9535
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018