Project name: 65r0

Chain sequence(s)	A: MIAGVDQALAATGQASQRAAGASGGVTVGVGVGTEQRNLSVVAPSQFTFSSRSPDFVDETAGQSWCAILGLNQFHFAVTNDGVI
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:31)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:32)

• Minimal score value: -3.3738
• Maximal score value: 2.515
• Average score: -0.6257
• Total score value: -52.5571

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	M	A	1.9367
2	I	A	2.5150
3	A	A	1.0982
4	G	A	0.1171
5	V	A	0.4512
6	D	A	-1.1651
7	Q	A	-1.3544
8	A	A	0.0000
9	L	A	-0.0528
10	A	A	-0.5696
11	A	A	0.0000
12	T	A	0.0000
13	G	A	0.0000
14	Q	A	-1.2389
15	A	A	0.0000
16	S	A	0.0000
17	Q	A	-2.2768
18	R	A	-2.4427
19	A	A	0.0000
20	A	A	-1.3608
21	G	A	-1.2085
22	A	A	-0.9779
23	S	A	-0.6615
24	G	A	-1.3155
25	G	A	-0.4401
26	V	A	0.0000
27	T	A	0.1594
28	V	A	0.0000
29	G	A	-1.4599
30	V	A	0.0000
31	G	A	0.0000
32	V	A	-1.0154
33	G	A	-1.2038
34	T	A	-1.5280
35	E	A	-3.0189
36	Q	A	-3.3213
37	R	A	-3.3738
38	N	A	-2.2264
39	L	A	-0.3605
40	S	A	0.8040
41	V	A	0.9574
42	V	A	1.8168
43	A	A	0.3515
44	P	A	-0.6179
45	S	A	-0.6476
46	Q	A	-0.8846
47	F	A	-0.2393
48	T	A	0.1693
49	F	A	0.1657
50	S	A	-0.6793
51	S	A	-1.0371
52	R	A	-2.2777
53	S	A	-1.6086
54	P	A	0.0000
55	D	A	-1.4499
56	F	A	-0.6356
57	V	A	-0.8224
58	D	A	-2.5442
59	E	A	-2.8194
60	T	A	-1.8364
61	A	A	-1.3135
62	G	A	-1.7945
63	Q	A	-2.1058
64	S	A	-1.7480
65	W	A	0.0000
66	C	A	0.0000
67	A	A	0.0000
68	I	A	-0.1429
69	L	A	0.0000
70	G	A	0.0192
71	L	A	0.7720
72	N	A	-0.5857
73	Q	A	-1.0019
74	F	A	0.0000
75	H	A	-1.0614
76	F	A	0.0000
77	A	A	-0.9300
78	V	A	-0.9306
79	T	A	-1.0396
80	N	A	-2.2917
81	D	A	-1.8595
82	G	A	-0.5478
83	V	A	1.6695
84	I	A	2.4654