Project name: bc913c2db70a35c

Status: done

Started: 2026-05-21 06:27:43
Settings
Chain sequence(s) A: MEKELIENLRKHLKKLLELCDYVVANLEIARPEAVEVIRELVPEERLLEVGKDDEKAVEIIKAGKRIGQVIRNEQGVVFLTPEQQALRKELEEKFFGEHPWIKSEITTDGDPYLELRVSYGPRP
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:02:50)
[INFO]       Main:     Simulation completed successfully.                                          (00:02:50)
Show buried residues

Minimal score value
-4.2976
Maximal score value
1.9375
Average score
-1.4026
Total score value
-173.9182

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 M A -0.9086
2 E A -2.7266
3 K A -3.4999
4 E A -3.3675
5 L A 0.0000
6 I A -2.7131
7 E A -3.4253
8 N A -2.7823
9 L A 0.0000
10 R A -3.3185
11 K A -3.3383
12 H A 0.0000
13 L A 0.0000
14 K A -3.2985
15 K A -2.7288
16 L A 0.0000
17 L A -1.5494
18 E A -2.1178
19 L A -0.5684
20 C A 0.0000
21 D A -1.2598
22 Y A -1.1110
23 V A 0.0000
24 V A 0.0000
25 A A -0.2976
26 N A -0.9585
27 L A -1.3172
28 E A -1.8128
29 I A -1.1684
30 A A -1.0262
31 R A -1.5728
32 P A -1.5800
33 E A -2.3949
34 A A 0.0000
35 V A -2.1653
36 E A -3.3094
37 V A 0.0000
38 I A 0.0000
39 R A -3.7091
40 E A -3.5215
41 L A -2.4496
42 V A 0.0000
43 P A -2.3215
44 E A -3.4241
45 E A -2.8657
46 R A -1.9075
47 L A -1.8126
48 L A 0.0000
49 E A -1.7674
50 V A -1.4493
51 G A -1.8616
52 K A -2.8429
53 D A -2.7516
54 D A -2.7651
55 E A -3.4449
56 K A -3.4469
57 A A 0.0000
58 V A 0.0000
59 E A -3.4454
60 I A 0.0000
61 I A 0.0000
62 K A -2.9327
63 A A -1.9263
64 G A -2.2292
65 K A -2.3960
66 R A -1.5878
67 I A 0.0000
68 G A 0.0000
69 Q A 0.0338
70 V A -0.1095
71 I A 0.3211
72 R A -0.3155
73 N A -1.1424
74 E A -1.8726
75 Q A -1.2719
76 G A 0.0000
77 V A 0.5325
78 V A 1.8378
79 F A 1.9375
80 L A 0.0000
81 T A -0.1713
82 P A -0.9230
83 E A -2.3033
84 Q A -1.8676
85 Q A -1.3343
86 A A -1.8878
87 L A -1.9977
88 R A -2.5540
89 K A -3.8475
90 E A -3.8050
91 L A -2.6875
92 E A -3.1383
93 E A -4.2976
94 K A -3.9561
95 F A -2.3190
96 F A -1.7469
97 G A -2.6265
98 E A -2.6764
99 H A -1.5296
100 P A -1.1469
101 W A -0.5309
102 I A 0.0000
103 K A -1.6639
104 S A -1.1879
105 E A -1.1780
106 I A 0.8137
107 T A 0.0329
108 T A -0.4785
109 D A -1.4556
110 G A -1.0789
111 D A 0.0000
112 P A -0.8929
113 Y A -0.4837
114 L A 0.0000
115 E A -0.1772
116 L A 0.0000
117 R A -0.0402
118 V A 0.0000
119 S A 0.0000
120 Y A 0.0000
121 G A 0.0000
122 P A -1.8714
123 R A -2.4592
124 P A -1.2254
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018