Project name: bce445dcd883d8b

Status: done

Started: 2026-06-26 14:30:58
Settings
Chain sequence(s) A: MSHHHHHHSGVLAEFLSLVRQLEELMDKFYKVFRRWKGTKSTDDRDEIYTVLEKMKQSLNKMAALLKAENSDSEESGKTGMEDFFKAYKVPESTQKHVRDTMNEVGWDMIYYHPYFENDAPIRQLMTEIFKILVQNFEFDPRKSGMFIWDDGYSIKAWNNFKELQKKLNIPNS
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:08:18)
[INFO]       Main:     Simulation completed successfully.                                          (00:08:19)
Show buried residues

Minimal score value
-3.8873
Maximal score value
1.1235
Average score
-1.3341
Total score value
-230.7953

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 M A 0.0967
2 S A -1.1139
3 H A -2.1335
4 H A -2.4293
5 H A -2.5951
6 H A -2.6806
7 H A -2.5144
8 H A -1.7737
9 S A -1.4712
10 G A -1.3002
11 V A -0.5672
12 L A -0.4365
13 A A -0.5642
14 E A -1.5576
15 F A 0.0000
16 L A -0.7370
17 S A -1.4128
18 L A 0.0000
19 V A 0.0000
20 R A -3.2636
21 Q A -2.9154
22 L A 0.0000
23 E A -3.7862
24 E A -3.8873
25 L A 0.0000
26 M A 0.0000
27 D A -2.9606
28 K A -2.5083
29 F A 0.0000
30 Y A -1.6221
31 K A -2.4170
32 V A 0.0000
33 F A 0.0000
34 R A -3.4936
35 R A -3.8022
36 W A -3.4275
37 K A -3.1612
38 G A -2.5548
39 T A -2.4765
40 K A -2.9076
41 S A -2.3960
42 T A -2.0123
43 D A -2.9284
44 D A -3.1204
45 R A -2.5505
46 D A -2.3909
47 E A -2.3847
48 I A 0.0000
49 Y A -1.3840
50 T A -1.5433
51 V A 0.0000
52 L A 0.0000
53 E A -2.8295
54 K A -2.7255
55 M A 0.0000
56 K A -2.3138
57 Q A -2.7960
58 S A 0.0000
59 L A 0.0000
60 N A -1.7882
61 K A -1.7846
62 M A 0.0000
63 A A 0.0000
64 A A -1.0109
65 L A -0.8012
66 L A 0.0000
67 K A -2.0837
68 A A -1.2623
69 E A -1.4220
70 N A -2.5963
71 S A -2.3278
72 D A -2.9344
73 S A -2.8299
74 E A -3.2882
75 E A -3.5009
76 S A -2.5535
77 G A -2.1891
78 K A -2.7768
79 T A -1.9800
80 G A -1.8668
81 M A 0.0000
82 E A -2.1700
83 D A -2.3496
84 F A 0.0000
85 F A 0.0000
86 K A -2.7251
87 A A -1.5867
88 Y A -1.4231
89 K A -2.5852
90 V A 0.0000
91 P A -2.1923
92 E A -2.9470
93 S A -2.1313
94 T A -2.0186
95 Q A -3.0169
96 K A -3.5447
97 H A -3.0294
98 V A 0.0000
99 R A -2.6616
100 D A -3.3626
101 T A 0.0000
102 M A 0.0000
103 N A -2.0899
104 E A -2.1066
105 V A 0.0000
106 G A 0.0000
107 W A -0.0199
108 D A 0.0000
109 M A 0.0000
110 I A 0.7609
111 Y A 0.9635
112 Y A 0.2807
113 H A -0.6195
114 P A -0.7174
115 Y A -0.4965
116 F A 0.0000
117 E A -2.5668
118 N A -2.2718
119 D A -1.7500
120 A A -1.3397
121 P A -0.8697
122 I A 0.0000
123 R A -1.8199
124 Q A -1.6325
125 L A 0.0000
126 M A 0.0000
127 T A -0.9558
128 E A -1.2122
129 I A 0.0000
130 F A -0.3764
131 K A -1.2218
132 I A -0.8606
133 L A 0.0000
134 V A -0.4658
135 Q A -1.3076
136 N A -1.1596
137 F A 0.0000
138 E A -1.1274
139 F A 0.0000
140 D A -1.8281
141 P A -1.5639
142 R A -2.6004
143 K A -2.6593
144 S A 0.0000
145 G A -0.6419
146 M A -0.2903
147 F A 0.3917
148 I A 1.1060
149 W A 1.1235
150 D A -0.7430
151 D A -0.3958
152 G A -0.0418
153 Y A 0.8163
154 S A 0.0000
155 I A 0.2314
156 K A -1.2488
157 A A -0.4686
158 W A 0.0390
159 N A -1.5822
160 N A -1.7785
161 F A -0.1505
162 K A -2.3868
163 E A -2.5892
164 L A -0.5414
165 Q A -1.4344
166 K A -2.8712
167 K A -1.9907
168 L A -0.1899
169 N A -1.3411
170 I A -0.2547
171 P A -0.8370
172 N A -1.8465
173 S A -0.7545
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018