Project name: KFDV_M

Chain sequence(s)	A: FLTAAVALCLAPTYALVAQSQDSKDSDCDDDCWKKKAKKPMILGAGILFLVTNFRRR
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:31)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:31)

• Minimal score value: -4.3667
• Maximal score value: 3.8381
• Average score: -0.0034
• Total score value: -0.1912

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	F	A	2.9012
2	L	A	2.8907
3	T	A	2.1008
4	A	A	2.1805
5	A	A	2.6319
6	V	A	3.2571
7	A	A	2.2424
8	L	A	2.6172
9	C	A	2.3816
10	L	A	2.1090
11	A	A	1.7846
12	P	A	1.5262
13	T	A	2.1288
14	Y	A	2.4440
15	A	A	1.6836
16	L	A	2.2039
17	V	A	1.9096
18	A	A	0.4090
19	Q	A	-0.8809
20	S	A	-1.4241
21	Q	A	-2.6421
22	D	A	-3.4171
23	S	A	-3.0089
24	K	A	-3.6411
25	D	A	-3.8641
26	S	A	-2.4761
27	D	A	-3.0439
28	C	A	-2.2486
29	D	A	-3.4633
30	D	A	-3.6341
31	D	A	-3.8061
32	C	A	-2.9024
33	W	A	-2.1429
34	K	A	-4.1529
35	K	A	-4.3667
36	K	A	-3.4614
37	A	A	-2.2796
38	K	A	-2.6252
39	K	A	-2.2220
40	P	A	-0.0802
41	M	A	1.0695
42	I	A	2.4305
43	L	A	2.5986
44	G	A	2.2945
45	A	A	2.7755
46	G	A	2.7328
47	I	A	3.2216
48	L	A	3.8381
49	F	A	3.6202
50	L	A	2.9987
51	V	A	2.1351
52	T	A	0.7275
53	N	A	0.1187
54	F	A	0.0677
55	R	A	-2.2473
56	R	A	-3.2172
57	R	A	-2.9741