Project name: bd2bc643575ae81

Chain sequence(s)	A: QVQLVQSGAEVKKPGSSVKVSCKASGFTFSSNVIGWFRQAPGQGLEFMGGVIPIVDIANYAQRFKGRVTITADISTSTTYMELSSLRSEDTAVYYCAASQYISRSVDEYDYWGQGTLVTVSS
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	No
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       runJob:   FoldX not utilized. Treating input pdb file as it was already optimized.    (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:00)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:01)

• Minimal score value: -2.9268
• Maximal score value: 2.8842
• Average score: -0.2786
• Total score value: -33.9899

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
2	Q	A	-1.1928
3	V	A	-0.3426
4	Q	A	-0.9730
5	L	A	0.0000
6	V	A	0.5340
7	Q	A	-0.1600
8	S	A	-0.4992
9	G	A	-0.3577
10	A	A	0.3951
11	E	A	0.2842
12	V	A	1.1267
13	K	A	-0.8873
14	K	A	-2.1867
15	P	A	-2.2903
16	G	A	-1.6193
17	S	A	-1.3254
18	S	A	-1.4566
19	V	A	0.0000
20	K	A	-2.1360
21	V	A	0.0000
22	S	A	-0.6803
23	C	A	0.0000
24	K	A	-1.3301
25	A	A	0.0000
26	S	A	-0.4897
27	G	A	-0.1654
28	F	A	1.3466
29	T	A	1.0655
30	F	A	0.0000
31	S	A	1.3045
32	S	A	0.8607
33	N	A	0.7400
34	V	A	1.4179
35	I	A	0.0000
36	G	A	0.0000
37	W	A	0.0000
38	F	A	0.0000
39	R	A	0.0000
40	Q	A	-0.2481
41	A	A	-0.8492
42	P	A	-1.1631
43	G	A	-1.1979
44	Q	A	-1.5849
45	G	A	-0.5805
46	L	A	0.9057
47	E	A	0.3583
48	F	A	1.0103
49	M	A	0.0000
50	G	A	0.0000
51	G	A	0.0000
52	V	A	0.0000
53	I	A	1.8454
54	P	A	0.0000
55	I	A	2.8842
56	V	A	2.2986
57	D	A	0.6957
58	I	A	1.9463
59	A	A	0.5757
60	N	A	-0.6613
61	Y	A	-0.6563
62	A	A	-1.2420
63	Q	A	-2.6816
64	R	A	-2.7874
65	F	A	0.0000
66	K	A	-2.9268
67	G	A	-1.7334
68	R	A	-1.3560
69	V	A	0.0000
70	T	A	-0.9451
71	I	A	0.0000
72	T	A	-0.0150
73	A	A	0.1854
74	D	A	-0.3331
75	I	A	1.2392
76	S	A	0.3099
77	T	A	-0.1779
78	S	A	-0.0422
79	T	A	0.0000
80	T	A	0.0000
81	Y	A	-0.7570
82	M	A	0.0000
83	E	A	-1.6640
84	L	A	0.0000
85	S	A	-1.1479
86	S	A	-1.1951
87	L	A	0.0000
88	R	A	-2.8589
89	S	A	-2.2411
90	E	A	-2.3401
91	D	A	0.0000
92	T	A	-0.5997
93	A	A	0.0000
94	V	A	0.6881
95	Y	A	0.0000
96	Y	A	0.4196
97	C	A	0.0000
98	A	A	0.0000
99	A	A	0.0000
100	S	A	-0.3338
101	Q	A	-0.4131
102	Y	A	0.7869
103	I	A	0.3847
104	S	A	-0.3747
105	R	A	-1.4371
106	S	A	-0.3464
107	V	A	0.6483
108	D	A	-1.2165
109	E	A	-1.6792
110	Y	A	-0.5978
111	D	A	-0.9339
112	Y	A	-0.0190
113	W	A	0.4587
114	G	A	0.0000
115	Q	A	-0.7194
116	G	A	-0.0620
117	T	A	0.0000
118	L	A	1.0633
119	V	A	0.0000
120	T	A	0.0324
121	V	A	0.0000
122	S	A	-0.8376
123	S	A	-0.7533