Project name: query_structure

Status: done

Started: 2026-03-17 00:13:26
Settings
Chain sequence(s) A: MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFWITYEEKFYRGEAIVLTVPGSKRSYDLTGLKPGTEYKVWIVGVKGGQGSWPLSAIFTTGG
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:05)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:05)
Show buried residues

Minimal score value
-3.0306
Maximal score value
2.1827
Average score
-0.6259
Total score value
-57.5786

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 M A 1.0247
2 L A 0.5927
3 P A 0.2522
4 A A 0.0336
5 P A 0.0000
6 K A -2.1137
7 N A -1.5398
8 L A -0.1629
9 V A 1.1546
10 V A 0.5902
11 S A -0.6029
12 R A -1.8337
13 V A -1.0722
14 T A -1.9027
15 E A -3.0174
16 D A -2.9705
17 S A -2.1491
18 A A 0.0000
19 R A -1.2190
20 L A 0.0000
21 S A -0.4028
22 W A 0.0000
23 T A -1.3245
24 A A -1.4224
25 P A -1.3339
26 D A -2.2643
27 A A -1.4392
28 A A -1.1743
29 F A 0.0000
30 D A -2.6898
31 S A -1.2422
32 F A 0.0000
33 W A 1.1880
34 I A 0.0000
35 T A 0.0000
36 Y A 0.2391
37 E A -0.8112
38 E A -1.1694
39 K A -0.8317
40 F A 1.0779
41 Y A 0.3123
42 R A -1.7240
43 G A -1.7781
44 E A -1.9697
45 A A -0.6414
46 I A 1.0686
47 V A 2.1827
48 L A 1.4992
49 T A 0.6715
50 V A 0.0000
51 P A -0.9750
52 G A 0.0000
53 S A -1.5679
54 K A -1.6317
55 R A -1.1112
56 S A -0.6565
57 Y A -0.7821
58 D A -1.6613
59 L A 0.0000
60 T A -1.4761
61 G A -1.5426
62 L A 0.0000
63 K A -3.0306
64 P A -2.6471
65 G A -1.9508
66 T A 0.0000
67 E A -1.0143
68 Y A 0.0000
69 K A -0.5007
70 V A 0.0000
71 W A 0.6904
72 I A 0.0000
73 V A 0.5265
74 G A 0.0000
75 V A -0.9835
76 K A -2.0268
77 G A -1.8192
78 G A -1.7680
79 Q A -1.6962
80 G A -0.2936
81 S A 0.0000
82 W A 1.4198
83 P A 0.4358
84 L A -0.0514
85 S A 0.2738
86 A A 0.8275
87 I A 0.9079
88 F A 0.0000
89 T A -0.9951
90 T A 0.0000
91 G A -1.8170
92 G A -1.7461
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018