Project name: bd5f60f5776bb32

Status: done

Started: 2026-05-14 08:12:40
Settings
Chain sequence(s) A: MRVLYLLFSFLFIFLMPLPGVFGGIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKPEAAKEEDIRKLVTMYPDNITIAEERKKRLSFFTGFDSVEHKKSENAEVLRRIAENAMASRRSSKSRTDDGPGPGKGEVVVNGRIAYVPQGPGPGRASIVFFDRNPIGNIAAYHLSFLTFSWGPGPGVFKNVSLRY
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:04:51)
[INFO]       Main:     Simulation completed successfully.                                          (00:04:53)
Show buried residues

Minimal score value
-4.7266
Maximal score value
5.8954
Average score
-0.3867
Total score value
-76.9459

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 M A 1.4389
2 R A 0.6111
3 V A 2.8449
4 L A 3.4627
5 Y A 3.4955
6 L A 3.7403
7 L A 4.2018
8 F A 4.6815
9 S A 4.5559
10 F A 5.5167
11 L A 5.4607
12 F A 5.8470
13 I A 5.8954
14 F A 5.6270
15 L A 4.9256
16 M A 3.9636
17 P A 2.6743
18 L A 2.9833
19 P A 1.0989
20 G A 1.0332
21 V A 2.5189
22 F A 2.5125
23 G A 0.6268
24 G A 0.2368
25 I A 0.2718
26 G A -0.1032
27 D A -0.3923
28 P A 0.5628
29 V A 1.3946
30 T A 0.2200
31 C A 0.0000
32 L A 1.2370
33 K A -0.6044
34 S A -0.2370
35 G A -0.5867
36 A A 0.0000
37 I A 0.6209
38 C A 0.9347
39 H A 0.4383
40 P A 1.0168
41 V A 2.2008
42 F A 1.9676
43 C A -0.1373
44 P A -1.2413
45 R A -2.7069
46 R A -3.1918
47 Y A -2.3868
48 K A -2.6176
49 Q A -1.5471
50 I A -0.6183
51 G A -0.8512
52 T A -0.7412
53 C A 0.0000
54 G A -0.2074
55 L A 0.7396
56 P A 0.2492
57 G A 0.3589
58 T A 0.4572
59 K A -0.1255
60 C A 0.0000
61 C A 0.0000
62 K A -1.7057
63 K A -2.7155
64 P A -2.2474
65 E A -2.4873
66 A A -1.7355
67 A A -2.1989
68 K A -4.1546
69 E A -4.3736
70 E A -4.7266
71 D A -4.1146
72 I A -2.8657
73 R A -3.6778
74 K A -3.1417
75 L A -1.0235
76 V A -0.5820
77 T A -0.4092
78 M A 0.8138
79 Y A 0.7732
80 P A -0.3355
81 D A -1.6889
82 N A -1.2169
83 I A 0.3808
84 T A -0.0521
85 I A -0.0110
86 A A -1.0917
87 E A -3.1120
88 E A -4.0532
89 R A -4.6169
90 K A -4.3716
91 K A -3.8551
92 R A -2.4177
93 L A 0.2577
94 S A 1.1897
95 F A 2.8571
96 F A 3.1053
97 T A 1.4372
98 G A 0.7836
99 F A 1.2504
100 D A -0.7793
101 S A -0.3114
102 V A 0.0315
103 E A -2.2622
104 H A -2.9183
105 K A -3.7285
106 K A -3.7279
107 S A -2.8838
108 E A -3.3731
109 N A -2.7683
110 A A -1.8971
111 E A -2.2261
112 V A -0.9245
113 L A -1.0248
114 R A -2.6328
115 R A -2.3684
116 I A 0.1370
117 A A -0.9445
118 E A -2.4466
119 N A -2.1369
120 A A -0.9169
121 M A -0.9614
122 A A -1.5318
123 S A -2.0558
124 R A -3.0244
125 R A -3.0704
126 S A -2.2809
127 S A -2.4337
128 K A -2.8840
129 S A -2.2681
130 R A -3.0261
131 T A -2.5627
132 D A -3.2855
133 D A -3.2228
134 G A -2.0398
135 P A -1.5055
136 G A -1.5209
137 P A -1.3619
138 G A -2.0517
139 K A -2.6525
140 G A -1.1767
141 E A -0.6450
142 V A 0.6834
143 V A 1.2762
144 V A 0.8486
145 N A -1.0144
146 G A -0.9639
147 R A -1.1425
148 I A 0.8104
149 A A 0.8544
150 Y A 0.7197
151 V A 0.1233
152 P A 0.0000
153 Q A -1.6409
154 G A -1.5146
155 P A -1.1725
156 G A -0.9047
157 P A -0.8890
158 G A -1.3658
159 R A -1.8728
160 A A -0.6827
161 S A 0.3069
162 I A 1.1655
163 V A 1.6305
164 F A 1.5456
165 F A 0.7203
166 D A -1.7325
167 R A -2.0058
168 N A -1.0822
169 P A -0.1714
170 I A 1.2526
171 G A -0.4233
172 N A -0.9365
173 I A -0.4735
174 A A -0.7257
175 A A -0.0783
176 Y A 1.1084
177 H A 0.6472
178 L A 1.2839
179 S A 0.0000
180 F A 0.4788
181 L A 0.3240
182 T A -0.4833
183 F A 0.0000
184 S A -0.5984
185 W A -0.4419
186 G A -0.5649
187 P A -0.4591
188 G A -0.3251
189 P A -0.7408
190 G A -0.8264
191 V A 0.1268
192 F A 0.1110
193 K A -1.4359
194 N A -0.8584
195 V A 0.9335
196 S A 0.5327
197 L A 0.4344
198 R A -0.5120
199 Y A 0.6456
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018