Project name: bd7f2575a050cb8

Status: done

Started: 2026-06-22 16:05:45
Settings
Chain sequence(s) B: RAFMDELMARLAKLEAVLAKLEELLSPETAAKVKAKFAEIKAKVEEIMAA
input PDB
Selected Chain(s) B
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with B chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:45)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:45)
Show buried residues

Minimal score value
-2.9138
Maximal score value
0.5309
Average score
-1.3915
Total score value
-69.5767

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 R B -1.7338
2 A B -0.7205
3 F B 0.5309
4 M B -0.8602
5 D B -2.2857
6 E B -1.9321
7 L B -1.3658
8 M B -1.3860
9 A B -1.8260
10 R B -2.7973
11 L B 0.0000
12 A B -1.3741
13 K B -1.8571
14 L B -0.6571
15 E B -1.2950
16 A B -0.6877
17 V B 0.5187
18 L B -0.3457
19 A B -1.1116
20 K B -1.4737
21 L B -0.3758
22 E B -1.8696
23 E B -1.9494
24 L B 0.2521
25 L B -0.2326
26 S B -0.9586
27 P B -1.6203
28 E B -2.5337
29 T B -1.5065
30 A B 0.0000
31 A B -2.0807
32 K B -2.7433
33 V B -1.9737
34 K B -2.4721
35 A B -2.0908
36 K B -2.8163
37 F B 0.0000
38 A B -2.0575
39 E B -2.9138
40 I B -2.0062
41 K B -2.1122
42 A B -2.4590
43 K B -2.8587
44 V B 0.0000
45 E B -2.6845
46 E B -2.4858
47 I B -0.4697
48 M B -1.0433
49 A B -0.7054
50 A B -0.1495
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018