Project name: bda9f997636c8c

Status: done

Started: 2026-06-18 07:12:40
Settings
Chain sequence(s) A: GEPPPGKPADDAGLVSRHWKRGFILKRGEPPPGKPADDAGLVSRHWKRGFILKRGEPPPGKPADDAGLVSRHWKRGFILKRGEPPPGKPADDAGLVSRHWKRGFILKRGEPPPGKPADDAGLVSRHWKRGFILKRGEPPPGKPADDAGLVSRHWKRGFILKRGEPPPGKPADDAGLVSRHWKRGFILKRGEPPPGKPADDAGLVSRHWKRGFILKRGEPPPGKPADDAGLV
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:02:13)
[INFO]       Main:     Simulation completed successfully.                                          (00:02:14)
Show buried residues

Minimal score value
-3.0069
Maximal score value
3.0743
Average score
-0.9938
Total score value
-229.5739

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 G A -1.4477
2 E A -2.2692
3 P A -1.4842
4 P A -1.3258
5 P A -1.3007
6 G A -1.6067
7 K A -2.3886
8 P A -2.0392
9 A A -1.9828
10 D A -2.9620
11 D A -2.4766
12 A A -1.0620
13 G A 0.1508
14 L A 1.5532
15 V A 1.5910
16 S A -0.0154
17 R A -1.6651
18 H A -1.8727
19 W A -1.1225
20 K A -2.4599
21 R A -2.1206
22 G A -0.0263
23 F A 2.3115
24 I A 2.6896
25 L A 1.7026
26 K A -1.4054
27 R A -2.7259
28 G A -2.5829
29 E A -2.8808
30 P A -1.4807
31 P A -1.1093
32 P A -1.3073
33 G A -1.5541
34 K A -2.0922
35 P A -1.7800
36 A A -1.7589
37 D A -2.7401
38 D A -2.6113
39 A A -0.8074
40 G A 0.1036
41 L A 1.7275
42 V A 1.7154
43 S A 0.0048
44 R A -1.6885
45 H A -1.7138
46 W A -1.0687
47 K A -2.3481
48 R A -2.3637
49 G A -0.0498
50 F A 2.3969
51 I A 3.0743
52 L A 1.5440
53 K A -1.4667
54 R A -2.7209
55 G A -2.6256
56 E A -2.8904
57 P A -1.6729
58 P A -1.2832
59 P A -1.2780
60 G A -1.5600
61 K A -2.3080
62 P A -1.8564
63 A A -1.8339
64 D A -2.9229
65 D A -2.5943
66 A A -0.7836
67 G A 0.0968
68 L A 1.6585
69 V A 1.5339
70 S A 0.0089
71 R A -1.8803
72 H A -1.7744
73 W A -1.1990
74 K A -2.4021
75 R A -2.2711
76 G A -0.3535
77 F A 2.4792
78 I A 2.7362
79 L A 1.4793
80 K A -2.0009
81 R A -2.9717
82 G A -2.6565
83 E A -2.8962
84 P A -1.5277
85 P A -0.9713
86 P A -1.2845
87 G A -1.5515
88 K A -2.0921
89 P A -1.7870
90 A A -1.7215
91 D A -2.7336
92 D A -2.5790
93 A A -0.9301
94 G A 0.1885
95 L A 1.6865
96 V A 1.6786
97 S A 0.1819
98 R A -1.6635
99 H A -1.7329
100 W A -1.1760
101 K A -2.4252
102 R A -2.0220
103 G A -0.0444
104 F A 2.2046
105 I A 2.7170
106 L A 1.6777
107 K A -1.3612
108 R A -2.7594
109 G A -2.6736
110 E A -2.8355
111 P A -1.4725
112 P A -1.2269
113 P A -1.2873
114 G A -1.5613
115 K A -2.1227
116 P A -1.8563
117 A A -1.6901
118 D A -2.7410
119 D A -2.6128
120 A A -0.9014
121 G A 0.0961
122 L A 1.6874
123 V A 1.5804
124 S A 0.0292
125 R A -1.5186
126 H A -1.7197
127 W A -1.1884
128 K A -2.3646
129 R A -2.0427
130 G A 0.0670
131 F A 2.2811
132 I A 2.6673
133 L A 1.5801
134 K A -1.3984
135 R A -2.6344
136 G A -2.6145
137 E A -2.8924
138 P A -1.7307
139 P A -1.2904
140 P A -1.2921
141 G A -1.5614
142 K A -2.1180
143 P A -1.7579
144 A A -1.7047
145 D A -2.7883
146 D A -2.8256
147 A A -0.9303
148 G A 0.0862
149 L A 2.2349
150 V A 1.9983
151 S A -0.1266
152 R A -1.7815
153 H A -1.9075
154 W A -1.0083
155 K A -2.3572
156 R A -2.1040
157 G A 0.0365
158 F A 2.4797
159 I A 2.6782
160 L A 1.5945
161 K A -1.3991
162 R A -2.6722
163 G A -2.6101
164 E A -2.8891
165 P A -1.7270
166 P A -1.2859
167 P A -1.2694
168 G A -1.5616
169 K A -2.1180
170 P A -1.8065
171 A A -1.7689
172 D A -2.7115
173 D A -2.7754
174 A A -0.9629
175 G A 0.3978
176 L A 1.9201
177 V A 1.9111
178 S A -0.1283
179 R A -1.5783
180 H A -1.9402
181 W A -1.0374
182 K A -2.1436
183 R A -2.0876
184 G A 0.0460
185 F A 2.2812
186 I A 2.6087
187 L A 1.5685
188 K A -1.3619
189 R A -2.6329
190 G A -2.5627
191 E A -2.9021
192 P A -1.7234
193 P A -1.2981
194 P A -1.2234
195 G A -1.5640
196 K A -2.2992
197 P A -1.8065
198 A A -1.8168
199 D A -2.9250
200 D A -2.7707
201 A A -0.9123
202 G A 0.0902
203 L A 1.9097
204 V A 1.7297
205 S A -0.0074
206 R A -1.6387
207 H A -1.5267
208 W A -0.9885
209 K A -2.3193
210 R A -1.7513
211 G A -0.1565
212 F A 2.2528
213 I A 2.4352
214 L A 1.3501
215 K A -1.5699
216 R A -2.5989
217 G A -2.4665
218 E A -3.0069
219 P A -1.9852
220 P A -1.4077
221 P A -1.4505
222 G A -1.5999
223 K A -2.4003
224 P A -1.9347
225 A A -1.9627
226 D A -3.0026
227 D A -2.6173
228 A A -0.9609
229 G A 0.0289
230 L A 2.0099
231 V A 2.4228
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018