Project name: 5G8

Chain sequence(s)	A: MGQWVEQTPTTTTKEAGESLTINCVLRDSSCPLASTYWYFTKKGATKKESLSNGGRYAETVNKASKSFSLRISDLRVEDSGTYHCKAVNSWTNCAPLERYYEGGGTILSVKP
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:04)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:05)

• Minimal score value: -3.1394
• Maximal score value: 0.5702
• Average score: -0.9267
• Total score value: -103.7866

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	M	A	0.3232
2	G	A	-0.7111
3	Q	A	-1.6208
4	W	A	-0.9390
5	V	A	0.0000
6	E	A	-1.2274
7	Q	A	-0.9701
8	T	A	-0.6093
9	P	A	-0.3243
10	T	A	-0.1547
11	T	A	0.1580
12	T	A	0.0117
13	T	A	-0.7766
14	K	A	-1.8809
15	E	A	-3.1394
16	A	A	-2.5925
17	G	A	-2.4332
18	E	A	-2.5313
19	S	A	-1.9715
20	L	A	0.0000
21	T	A	-1.0569
22	I	A	0.0000
23	N	A	-1.0593
24	C	A	0.0000
25	V	A	-0.8845
26	L	A	0.0000
27	R	A	-2.0140
28	D	A	-2.3457
29	S	A	-1.5181
30	S	A	-0.9392
31	C	A	0.0000
32	P	A	-0.3412
33	L	A	0.0000
34	A	A	-0.5392
35	S	A	-0.1465
36	T	A	0.1562
37	Y	A	0.2342
38	W	A	0.0000
39	Y	A	-0.7381
40	F	A	0.0000
41	T	A	-2.2534
42	K	A	-2.8918
43	K	A	-2.5710
44	G	A	-1.7361
45	A	A	-1.8161
46	T	A	-1.9009
47	K	A	-2.9773
48	K	A	-3.0718
49	E	A	-2.6466
50	S	A	-0.9427
51	L	A	-0.5965
52	S	A	-1.0327
53	N	A	-1.9129
54	G	A	-1.4492
55	G	A	-1.3756
56	R	A	-1.8260
57	Y	A	-1.6751
58	A	A	-1.5572
59	E	A	-1.1782
60	T	A	-0.7963
61	V	A	-0.3329
62	N	A	-1.3496
63	K	A	-1.6078
64	A	A	-0.9232
65	S	A	-0.9307
66	K	A	-1.1113
67	S	A	-0.9131
68	F	A	0.0000
69	S	A	-0.8787
70	L	A	0.0000
71	R	A	-2.2527
72	I	A	0.0000
73	S	A	-2.0708
74	D	A	-2.9120
75	L	A	0.0000
76	R	A	-2.4470
77	V	A	-1.0865
78	E	A	-2.2697
79	D	A	0.0000
80	S	A	-1.4419
81	G	A	0.0000
82	T	A	-0.5936
83	Y	A	0.0000
84	H	A	-0.6948
85	C	A	0.0000
86	K	A	-0.4730
87	A	A	0.0000
88	V	A	0.0000
89	N	A	0.0000
90	S	A	-0.1748
91	W	A	0.5702
92	T	A	-0.0221
93	N	A	-0.7663
94	C	A	0.0446
95	A	A	-0.1756
96	P	A	0.0390
97	L	A	0.5440
98	E	A	-1.2132
99	R	A	-1.7838
100	Y	A	-0.7059
101	Y	A	0.0000
102	E	A	-1.3527
103	G	A	0.0000
104	G	A	-0.9034
105	G	A	0.0000
106	T	A	0.0000
107	I	A	0.3265
108	L	A	0.0000
109	S	A	-1.0447
110	V	A	0.0000
111	K	A	-2.5131
112	P	A	-1.5771