Project name: query_structure

Status: done

Started: 2026-03-17 00:11:20
Settings
Chain sequence(s) A: MGSSHHHHHHYYLEVDNKFNKEFYHAMKEILKLPNLNKYQKEAFKTSLKDDPSQSANLLAEAKKLNDAQAPKVD
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:58)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:58)
Show buried residues

Minimal score value
-3.3863
Maximal score value
1.959
Average score
-1.4088
Total score value
-104.2531

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 M A 0.7649
2 G A -0.1787
3 S A -0.5283
4 S A -1.2534
5 H A -2.0539
6 H A -2.4391
7 H A -2.6112
8 H A -2.4771
9 H A -1.9318
10 H A -0.6940
11 Y A 1.3419
12 Y A 1.9590
13 L A 1.3271
14 E A -0.8525
15 V A -1.2387
16 D A -2.6151
17 N A -2.8817
18 K A -2.5597
19 F A -1.2087
20 N A -1.9896
21 K A -2.7702
22 E A -2.8394
23 F A 0.0000
24 Y A -1.0013
25 H A -2.1876
26 A A 0.0000
27 M A 0.0000
28 K A -1.5242
29 E A -1.8220
30 I A 0.0000
31 L A -1.0498
32 K A -1.7633
33 L A -1.3574
34 P A -0.9805
35 N A -1.4199
36 L A 0.0000
37 N A -1.5004
38 K A -1.9466
39 Y A -0.6600
40 Q A -1.0241
41 K A -1.7171
42 E A -2.2505
43 A A -1.4073
44 F A 0.0000
45 K A -1.9408
46 T A -2.2002
47 S A -2.1491
48 L A 0.0000
49 K A -2.9768
50 D A -3.3863
51 D A -2.5748
52 P A -2.1531
53 S A -1.5204
54 Q A -1.9886
55 S A 0.0000
56 A A -1.3083
57 N A -1.7721
58 L A -1.6693
59 L A -1.5827
60 A A -1.8990
61 E A -2.9635
62 A A 0.0000
63 K A -2.8585
64 K A -3.2287
65 L A -1.8765
66 N A 0.0000
67 D A -3.1441
68 A A -1.8517
69 Q A -1.8566
70 A A -1.4649
71 P A -1.2585
72 K A -1.7890
73 V A 0.0056
74 D A -1.5030
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018